PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009104270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 245aa    MW: 26753.9 Da    PI: 7.5365
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009104270.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.44.1e-18165199135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  XP_009104270.1 165 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRL 199
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.7E-842243IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.385159195IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-15159209IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.62E-14162223No hitNo description
Gene3DG3DSA:3.30.50.101.3E-13163197IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.08E-13164211No hitNo description
PROSITE patternPS003440165190IPR000679Zinc finger, GATA-type
PfamPF003206.6E-16165199IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDVYGLSSPD LLPIDDLLDF SNDEIFSSSS TVVSSATSSA ASSSENPFNF PSPASTSFHT  60
SPPPPPLTDF AHDLCVPSDD AAHLEWLSRF VDDSFSDYPA NPLTMTVRPE TSFTGKPRSR  120
RSRATAPSVT GTWAPTPEAE LCHSVAKRRP TKKLEAAEGG GARRCTHCAS EKTPQWRTGP  180
LGPKTLCNAC GVRFKSGRLV PEYRPASSPT FVLTQHSNSH RKVMELRRQK EQLESAVHLL  240
PFQPQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.92480.0seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531960.0AK353196.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-22-H09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104270.11e-180PREDICTED: GATA transcription factor 4-like
RefseqXP_013648415.11e-180PREDICTED: GATA transcription factor 4-like
SwissprotO497431e-123GATA4_ARATH; GATA transcription factor 4
TrEMBLA0A078BY121e-180A0A078BY12_BRANA; BnaA07g18730D protein
TrEMBLM4CGT61e-180M4CGT6_BRARP; Uncharacterized protein
STRINGBra003419.1-P1e-180(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32032666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.11e-108GATA transcription factor 4