PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009102984.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 374aa    MW: 41575.4 Da    PI: 7.9444
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009102984.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.32.5e-39155231177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +Cq++gCe dls+ak+yhr+h+vCe hsk+pvv+v g e+rfCqqCsr h++sefDe+krsCr+rL++hn+rrrk+q
  XP_009102984.1 155 RCQIDGCELDLSSAKDYHRKHRVCESHSKCPVVTVGGFERRFCQQCSRLHAVSEFDEKKRSCRKRLSHHNARRRKPQ 231
                     6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-31148217IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.616153230IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.05E-37154232IPR004333Transcription factor, SBP-box
PfamPF031105.7E-30156229IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MDCNMVSPLW DWEHLIIPNL SKTETDKKQP STTDWDIEKG EGIESILFPS FTGSSSTTGF  60
LSSQLTSTNS SSPKLKSSLG DFDQVKASTA LQVVSAESDL CLKLGKRSYS DEETWGRNNN  120
NDISAAVSVK LLTPPSVVAL KKSKSSCGQS MQVPRCQIDG CELDLSSAKD YHRKHRVCES  180
HSKCPVVTVG GFERRFCQQC SRLHAVSEFD EKKRSCRKRL SHHNARRRKP QGMFPLNPER  240
VYNGRQHTNM LWNELSLNTG SEEKYAWGTT TYETKPTQME SGFTLNFQRG SGAEEQQVFA  300
SSNLSFSAYQ TSAGKSNVQL PSKGVGEYSG GLYETQDFYS ALSLLSTSSD SHGTKHHPMV  360
ESQPIHGIFP THFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-251562291184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1211228KKRSCRKRLSHHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009102983.10.0PREDICTED: squamosa promoter-binding-like protein 10 isoform X1
RefseqXP_009102984.10.0PREDICTED: squamosa promoter-binding-like protein 10 isoform X1
SwissprotQ8S9L01e-178SPL10_ARATH; Squamosa promoter-binding-like protein 10
TrEMBLM4EMM10.0M4EMM1_BRARP; Uncharacterized protein
STRINGBra030041.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.41e-150squamosa promoter binding protein-like 10