PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009102342.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRF
Protein Properties Length: 252aa    MW: 29063.8 Da    PI: 9.7274
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009102342.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.42.6e-2375116142
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrks 42 
                     daepgrCrRtDGKkWRCs+++ +++k+CErH+hrg++rs+++
  XP_009102342.1  75 DAEPGRCRRTDGKKWRCSKDASPDSKYCERHMHRGKNRSSRK 116
                     79*************************************985 PP

2QLQ55.91.3e-19641237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FT +Q+++L++Q+l++Ky+aan PvPp+Ll+ i++
  XP_009102342.1  6 HFTESQWEELENQALVFKYIAANIPVPPHLLFLIRR 41
                    7*******************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-12541IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.52641IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.6E-14640IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.30575119IPR014977WRC domain
PfamPF088793.1E-1976116IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MTTRIHFTES QWEELENQAL VFKYIAANIP VPPHLLFLIR RPFLFSSSAY SSSPNFFSPH  60
FGWNVYEMGK ERKIDAEPGR CRRTDGKKWR CSKDASPDSK YCERHMHRGK NRSSRKPLPP  120
PPQFYVPSTP SIFLDFSLSS SRAKSKRTGY MNDFFSIEPS GSIKSCSGLA MEGDGGSSKY  180
ESLKQREKQT DRSCFIVGTE LGTLERPLML VAKQKQRDDK DYEEEEQRSK RFYKFLDEWP  240
SSKSSGSTSL FI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00263DAPTransfer from AT2G06200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1255721e-66AY125572.1 Arabidopsis thaliana At2g06200/F5K7.4 mRNA, complete cds.
GenBankAY0605861e-66AY060586.1 Arabidopsis thaliana At2g06200/F5K7.4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009102342.10.0PREDICTED: growth-regulating factor 6
SwissprotQ9ZQ121e-108GRF6_ARATH; Growth-regulating factor 6
TrEMBLM4DFB20.0M4DFB2_BRARP; Uncharacterized protein
STRINGBra015184.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM141011821
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G06200.11e-104growth-regulating factor 6