PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009102066.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WOX
Protein Properties Length: 267aa    MW: 29357.4 Da    PI: 6.5695
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009102066.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.57.3e-163191257
                    T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    r+R+++++eq+ +Le+ F++   +p +ee  ++ k l     + +++V++WFqNrR + ++
  XP_009102066.1 31 RSRWSPKPEQILILESIFNSgMVNPPKEETVRIRKMLekfgAVGDANVFYWFQNRRSRSRR 91
                    89*****************99*************************************997 PP

2Wus_type_Homeobox107.67.6e-353093265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RW+P+peQi iLe++++sG+++P+kee+ ri+++Le++G+++d+NVfyWFQNr++R+r++q
     XP_009102066.1 30 VRSRWSPKPEQILILESIFNSGMVNPPKEETVRIRKMLEKFGAVGDANVFYWFQNRRSRSRRRQ 93
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.14E-142298IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-92597IPR009057Homeodomain-like
PROSITE profilePS5007111.5482792IPR001356Homeobox domain
SMARTSM003892.1E-62996IPR001356Homeobox domain
PfamPF000461.3E-133191IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MDQEQTQHSP TGHSHSPSSP ASGSTSTETV RSRWSPKPEQ ILILESIFNS GMVNPPKEET  60
VRIRKMLEKF GAVGDANVFY WFQNRRSRSR RRQRQLQAAA AAVTTNTCDQ TMMVNTSLPQ  120
YSGADLGFGG CSTSSNYLYA SSSTSSYGGG YDNHSNNGME NLLAMSGQLG YHEASQHHYQ  180
HHSSNLSPMM CPSDQSSSYD HYQQGLTVFI NGVPTEVTSG GIDMKAMFGE DLVLVHSSGV  240
PLPTDEFGFL MHSLQHGEAY FLVPRQT
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00330DAPTransfer from AT3G03660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_009102066.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2514020.0AY251402.1 Arabidopsis thaliana WOX11 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009102066.10.0PREDICTED: WUSCHEL-related homeobox 11-like isoform X2
SwissprotQ6X7J31e-146WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLA0A398AZQ90.0A0A398AZQ9_BRACM; Uncharacterized protein
STRINGBra036446.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.11e-117WUSCHEL related homeobox 11
Publications ? help Back to Top
  1. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]
  2. Sheng L, et al.
    Non-canonical WOX11-mediated root branching contributes to plasticity in Arabidopsis root system architecture.
    Development, 2017. 144(17): p. 3126-3133
    [PMID:28743799]
  3. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]
  4. Baesso B, et al.
    Transcription factors PRE3 and WOX11 are involved in the formation of new lateral roots from secondary growth taproot in A. thaliana.
    Plant Biol (Stuttg), 2018. 20(3): p. 426-432
    [PMID:29450949]