PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009101447.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 462aa    MW: 51955.7 Da    PI: 7.2774
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009101447.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.43e-16741135
            GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                    C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  XP_009101447.1  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGS 41
                    ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.3E-10155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.47E-11545No hitNo description
CDDcd002022.37E-16653No hitNo description
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.109.1E-13740IPR013088Zinc finger, NHR/GATA-type
PfamPF003205.2E-14741IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PfamPF139191.4E-6238328IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG SLVNYTPLHS RAEVDDINDH  60
RPPKMMMMNK KIPKRRPYQE NFTVKRTNYE FNNGFKKRTL DELEASNRSS SGSVVSNSES  120
CDQSNAWETT FPSKKRTCVV GRPKAASSVE KLTKDLYSIL QEQQSSCLSG TSEEDLLFEN  180
ESPMVIGHGS VLLRDPHEES EASSLLVESS KSSSMHSAEF VVNKSQRSLN FGCRTKPQVL  240
GRHSLPLCNI DLKNVFNFDE FIEKFTKEEQ QKLMKLLPGV DSVDLPESLR SMFECSQFKD  300
NFSLFQQLVA DGVFQPLSSS SSSSGSKLEE LKTLAKLALS DPNKSHLLES YHMLKRKGIQ  360
DSVTKSSDNH SLVTIERPCE SLNQNFSETR TVMKSPKEMI KIRSKQIQTK EIIENSVSCL  420
NHMSYGGSMA YSYEDNDISD QDLLLDVPSN GSYPQAELLH MI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892610.0AC189261.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB021P11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009101447.10.0PREDICTED: GATA transcription factor 27-like isoform X2
SwissprotQ5PP380.0GAT27_ARATH; GATA transcription factor 27
TrEMBLA0A0D3D9S10.0A0A0D3D9S1_BRAOL; Uncharacterized protein
STRINGBra024961.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47140.10.0GATA transcription factor 27