PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bathy15g00870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Bathycoccus
Family ARR-B
Protein Properties Length: 581aa    MW: 61318.8 Da    PI: 9.8135
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bathy15g00870genomeORCAEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.12.2e-29341394155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr++W+ eLH++Fv+av+qL G++kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Bathy15g00870 341 KPRVVWSAELHQQFVNAVNQL-GIDKAVPKRILDLMNVQGLTRENVASHLQKYRL 394
                    79*******************.********************************8 PP

2Response_reg839.4e-28141221109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl+vdD+ l +++++++l+k gy  v++++++  ale+l++k+  +D++l D+ mp+mdG++ll++i+    ++p+++++ +++++ +l+ +  Ga
  Bathy15g00870  14 VLVVDDDVLCLKIVTKMLQKCGY-TVTSTTSSVTALEYLRTKKeeFDIVLSDVHMPDMDGFKLLEQIALDI-DIPVLMMSVNADQSVVLRGIIHGA 107
                    89*********************.***************777777**********************9877.9*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ + el +
  Bathy15g00870 108 VDYLLKPVRIHELKN 122
                    **********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521726.69E-3510129IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.8E-3911135No hitNo description
SMARTSM004489.0E-3212124IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.44313128IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-2414122IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.51E-2515127No hitNo description
PROSITE profilePS5129412.084338397IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-31339399IPR009057Homeodomain-like
SuperFamilySSF466895.55E-20339398IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-25341394IPR006447Myb domain, plants
PfamPF002495.4E-8343393IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MSGRSTPTIP NLRVLVVDDD VLCLKIVTKM LQKCGYTVTS TTSSVTALEY LRTKKEEFDI  60
VLSDVHMPDM DGFKLLEQIA LDIDIPVLMM SVNADQSVVL RGIIHGAVDY LLKPVRIHEL  120
KNIWQHVVRK NGPDSLQRSG SMSMSPARSG RGSPEKDSGM NATSNGTHMN KKLRTIAAAN  180
NAVSTDASAA AKGNKKPSTV EGVAQLQQQQ QQQQQTTTSG NDNNNNNNNN STAPVPLPGG  240
AGPGQQQQQN QINVQGHLGG GHPPLQSTHQ QQQQQQHVDG SASAIPSARR PPPMGYLDPN  300
NMMSGNPTTA GGVDMNGMPM QGNGAPGAGQ SGGSSGGGSK KPRVVWSAEL HQQFVNAVNQ  360
LGIDKAVPKR ILDLMNVQGL TRENVASHLQ KYRLYLKRLQ GGPNNPSGPG FLSNKIAGGA  420
TGASKPSGSG KSKNNASKVS VPGGSYQFHP GVGAPPQQWN QGMPPQQHQQ QQQQQQQQAP  480
PHMVAAGGPG GMPPQQHPPQ YSTFPHPQGV ITPGPPPPGT VRYGYGPVPI DASSFTPIPL  540
DFDDTGLGLG IGTSKGSFGS KSTDDMLSMF LKDGDPESIL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-22338399263ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFO0822640.0FO082264.1 Bathycoccus prasinos genomic : Chromosome_15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007508971.10.0type-b response regulator
TrEMBLK8EP920.0K8EP92_9CHLO; Two-component response regulator
STRINGXP_007508971.10.0(Bathycoccus prasinos)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP12201516
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-36response regulator 2