PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bathy12g03630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Bathycoccus
Family WOX
Protein Properties Length: 449aa    MW: 50963.7 Da    PI: 5.868
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bathy12g03630genomeORCAEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.53e-15356416257
                    T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
       Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                    + R+++t+ q e+Le+lF+  + +p++e  ++ +++l     ++e++V++WFqN++a+ kk
  Bathy12g03630 356 KVRWQPTTAQFERLEQLFAIdTTTPQRENLKQVTEELsalgPIQECNVYNWFQNKKARLKK 416
                    67*****************88*****************9999****************997 PP

2Wus_type_Homeobox681.7e-22356417364
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        + RW Pt+ Q + Le+l+   + tP++e+++++t+eL++ G i++ NV++WFQN+kaR +++
      Bathy12g03630 356 KVRWQPTTAQFERLEQLFAIDTTTPQRENLKQVTEELSALGPIQECNVYNWFQNKKARLKKR 417
                        67********************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.661352417IPR001356Homeobox domain
SMARTSM003891.9E-4354421IPR001356Homeobox domain
SuperFamilySSF466891.37E-11354421IPR009057Homeodomain-like
CDDcd000862.78E-4356418No hitNo description
Gene3DG3DSA:1.10.10.602.3E-8356422IPR009057Homeodomain-like
PfamPF000467.1E-13356416IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MVLNESARAV SVSSFLSYVC VCNSPVSHSF EIAFSTSLAE TSMCTCVRAC VCVYTDVFFR  60
VRARRTFPET SHREERLFYN CFSNDLFSFL WSDGLYPDPR TLTLISVFHK NHRAENSSQK  120
HLISIHHRPH NLKRVWKTRE TFHHAMSSLA EQPPQAAAQE GAVDTTITTA ADAAEKNKND  180
DDVEMKEAND NIIITTTAPA APPSAAAAEI DDGAAADEEE EDAGGEKNEQ EEKEEKEQEE  240
EEEREKYDPK EGPKILANVP DLPRNAALHM TEQQKYALRQ QIASYAHICQ QLLQLTHEAA  300
LRDLQMSARG EYDRHATHAS SAYPREKQPK KEKPHKERKT PASIFSNTGV YSVPGKVRWQ  360
PTTAQFERLE QLFAIDTTTP QRENLKQVTE ELSALGPIQE CNVYNWFQNK KARLKKREQD  420
AARERMEEEM RAKADQYNAQ QQQMGNLS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFO0822670.0FO082267.1 Bathycoccus prasinos genomic : Chromosome_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007509709.10.0predicted protein
TrEMBLK8ELH40.0K8ELH4_9CHLO; Uncharacterized protein
STRINGXP_007509709.10.0(Bathycoccus prasinos)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP644567
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.14e-18WUSCHEL related homeobox 13