PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013639481.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 194aa    MW: 21717.5 Da    PI: 7.5493
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013639481.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.61.1e-152063649
                    HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +  r vtfskR+ngi  K +ELS+LC+a+v  +i+s +gk +++
  XP_013639481.1 20 NEDRMVTFSKRKNGIYTKLSELSILCGADVGFLIYSGSGKPFTF 63
                    56799***********************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.637767IPR002100Transcription factor, MADS-box
SMARTSM004325.4E-22766IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-23780IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-16929IPR002100Transcription factor, MADS-box
PfamPF003192.3E-191763IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-162944IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-164465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MGGKKTKGRQ KIDIKKVTKN EDRMVTFSKR KNGIYTKLSE LSILCGADVG FLIYSGSGKP  60
FTFGSPSFDD VAQRFLHGNH HSGIINGEGY SSSSLIVDAH KKVKMDEFCK NLNNLMEIKT  120
DAEEEKLKMA EAAYAPTLPV NSDASWKVDS KDDEEEKQLL RRYEEYYEEL CEVAAAKIRG  180
RYDASASSSF PQHG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013639481.11e-144PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A078EFL51e-144A0A078EFL5_BRANA; BnaC05g22890D protein
TrEMBLA0A0D3CEM41e-144A0A0D3CEM4_BRAOL; Uncharacterized protein
STRINGBra032347.1-P1e-108(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29962.19e-48AGAMOUS-like 64