PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013639399.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 536aa    MW: 60418.2 Da    PI: 7.9118
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013639399.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.42.2e-12241031297
                     HTT-EE--HHH.HTT....---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3  12 ksgrlvlpkkfaeeh....ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      ++ l +p  f+ +h    +  +   kt +l++  s ++W vk+  ++      lt+GW++F+  ++L+ gD+ +F+++g++ f  +v++f
  XP_013639399.1  24 HTH-LNIPVAFFLKHvqglS--NDHIKTAKLTTdASTKTWLVKV--DGV----RLTDGWEDFAVGHDLRIGDITIFRHEGEMVF--HVTAF 103
                     444.99**********9552..444456666554999*******..555....5***********************9998888..88776 PP

2B364.81.4e-20158252599
                     -..-HHHHTT-EE--HHH.HTT---...--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkke.esktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      +++++l+s+rl++p  fa+++g+++  +++ ++l +e+grsW+++++y+k + +++ + GW++F+ +ng+k g   +Fkl++ +++ +v+++ r
  XP_013639399.1 158 HVSPSSLSSDRLYIPTGFARSNGLNNMsGKQIIVLLNEEGRSWNLNMTYNKVGMQTFVRPGWRRFCAENGMKKGHQYTFKLVR-KSAPPVIRLSR 251
                     567899999*************666551445688999*******************************************998.88889999887 PP

                     S CS
              B3  99 k 99 
                     +
  XP_013639399.1 252 A 252
                     6 PP

3B358.89.5e-19273364699
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     ++s++l+++ l+l ++f++++g++k  s ++tl++e+g sW + l++    ++++l+ GWk F++ang+k+ D++++kl++ ++ ++v+ ++++
  XP_013639399.1 273 VSSNSLTTDKLYLQRQFVTTNGLEKGLS-EITLKNEWGGSWILGLRHYEPHNHTYLGPGWKTFCQANGIKAEDSFMLKLVE-TGDTPVLLLCSS 364
                     67899999***************99887.****************998888999************************998.666688888875 PP

4B350.53.6e-16438534298
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvv 94 
                     +  +++ ++lk++ l+lp  f++ +g++k  +++++l  ++g ++  v l  +k+sg++ ++kGW+eF++a+g+k+g+++ ++l ++ +e  +v+
  XP_013639399.1 438 VRLTLTQSALKTSVLYLPLAFTRMNGINK--PRKIMLLGKDGvKKQVVDLLKNKSSGTMRIGKGWREFCDAHGVKVGESFQLELFREdEESIPVL 530
                     55667889999999************996..558********7777777877999999*************************998768888888 PP

                     EEE- CS
              B3  95 kvfr 98 
                     k++ 
  XP_013639399.1 531 KFCT 534
                     8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.0E-1710113IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-1910108IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.78512106IPR003340B3 DNA binding domain
CDDcd100178.67E-1313103No hitNo description
SMARTSM010191.6E-1715106IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-20147247IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.63E-18150250IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.706154253IPR003340B3 DNA binding domain
CDDcd100172.26E-17155251No hitNo description
SMARTSM010199.5E-26155253IPR003340B3 DNA binding domain
PfamPF023624.4E-19157252IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-17263364IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.46E-16267365IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.422268364IPR003340B3 DNA binding domain
SMARTSM010197.8E-20269365IPR003340B3 DNA binding domain
PfamPF023621.7E-17273364IPR003340B3 DNA binding domain
CDDcd100178.59E-13274363No hitNo description
SuperFamilySSF1019361.28E-17433533IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.5E-15434534IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.8E-23437536IPR003340B3 DNA binding domain
PROSITE profilePS5086312.21437535IPR003340B3 DNA binding domain
PfamPF023628.9E-15437533IPR003340B3 DNA binding domain
CDDcd100171.98E-14441525No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MADDQSLHSP ITPHFFQPLL PGFHTHLNIP VAFFLKHVQG LSNDHIKTAK LTTDASTKTW  60
LVKVDGVRLT DGWEDFAVGH DLRIGDITIF RHEGEMVFHV TAFGPSCCDI QYTSASSHNI  120
NDDGQDQTNN TGERRKRVKK NPRTKEDSSS DHSQFVAHVS PSSLSSDRLY IPTGFARSNG  180
LNNMSGKQII VLLNEEGRSW NLNMTYNKVG MQTFVRPGWR RFCAENGMKK GHQYTFKLVR  240
KSAPPVIRLS RAEHESKLAP ESSLHHSYFM GSVSSNSLTT DKLYLQRQFV TTNGLEKGLS  300
EITLKNEWGG SWILGLRHYE PHNHTYLGPG WKTFCQANGI KAEDSFMLKL VETGDTPVLL  360
LCSSNRGKTP LECSEDRDDV NSVSSDTSCE DDSKEESQES DKESIEDEDS SRQCIVMEKE  420
KNSLRCICSS PYSKYRFVRL TLTQSALKTS VLYLPLAFTR MNGINKPRKI MLLGKDGVKK  480
QVVDLLKNKS SGTMRIGKGW REFCDAHGVK VGESFQLELF REDEESIPVL KFCTTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013639399.10.0PREDICTED: B3 domain-containing protein REM17-like
SwissprotQ84WP31e-159REM17_ARATH; B3 domain-containing protein REM17
TrEMBLA0A0D3CDE60.0A0A0D3CDE6_BRAOL; Uncharacterized protein
STRINGBra024697.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57811648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.11e-155B3 family protein