PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013638736.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 436aa    MW: 48818.3 Da    PI: 6.394
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013638736.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4792.3e-146524331374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lLl+cA++++sg+l++a+a+L +ls+l+s        +aayfteALa+r+++s+++lykal++++t+++n+see+++++lf++++Pilk+s+
  XP_013638736.1  52 LIHLLLTCANHMASGSLQNANAALDQLSHLVSX-------VAAYFTEALANRILKSWPGLYKALNATQTKTNNVSEEVHVRRLFFDMFPILKLSY 139
                     689***************************996.......9****************************************************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     l++N+aIlea+ege++vH+iD+d+s+++QW+aL+qa++sRpegpp+lRiTgv+     +ke l ++++rL + Ae+l++pf+fn+ v+++l++l+
  XP_013638736.1 140 LLTNRAILEAMEGEKMVHVIDLDASEPAQWLALIQAFNSRPEGPPHLRITGVHL----HKEVLDQMAHRLIEEAEKLDIPFQFNP-VVSSLDCLN 229
                     ******************************************************....9**************************.799****** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrll..................desvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                     +++Lrvk+gEalaV++vlqlh++l                  ++s++l++  ++d++L+++++lsPk++vv+eq +dhn+++++er+le+l+ y+
  XP_013638736.1 230 VDQLRVKTGEALAVSSVLQLHTFLasdsdmsnnnghslsgdsASSLPLSNsgKIDRFLNAIWGLSPKIMVVTEQHSDHNGSTLMERLLESLYSYA 324
                     ****************************************99666666666699***************************************** PP

            GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                     alfd+le+k+pr+s++rikvE++l+g+ei+n++aceg+errerhe+lekW++r++ aGF++vpls++++ qa++ l+ +++ gy+++eesg++v+
  XP_013638736.1 325 ALFDCLENKIPRTSQDRIKVEKMLFGEEIKNIIACEGSERRERHEKLEKWSQRIDLAGFGNVPLSYYVMLQARRXLQGYGFYGYMIKEESGCAVI 419
                     *********************************************************************************************** PP

            GRAS 361 gWkdrpLvsvSaWr 374
                     +W+drpL+svSaWr
  XP_013638736.1 420 CWQDRPLYSVSAWR 433
                     *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.64426413IPR005202Transcription factor GRAS
PfamPF035148.0E-14452433IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MVATFQEDTA PSSVSSSPLQ VFSTMSLTRP TLLSSSSSSF QDLKPEERGL ILIHLLLTCA  60
NHMASGSLQN ANAALDQLSH LVSXVAAYFT EALANRILKS WPGLYKALNA TQTKTNNVSE  120
EVHVRRLFFD MFPILKLSYL LTNRAILEAM EGEKMVHVID LDASEPAQWL ALIQAFNSRP  180
EGPPHLRITG VHLHKEVLDQ MAHRLIEEAE KLDIPFQFNP VVSSLDCLNV DQLRVKTGEA  240
LAVSSVLQLH TFLASDSDMS NNNGHSLSGD SASSLPLSNS GKIDRFLNAI WGLSPKIMVV  300
TEQHSDHNGS TLMERLLESL YSYAALFDCL ENKIPRTSQD RIKVEKMLFG EEIKNIIACE  360
GSERRERHEK LEKWSQRIDL AGFGNVPLSY YVMLQARRXL QGYGFYGYMI KEESGCAVIC  420
WQDRPLYSVS AWRCSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-584443211378Protein SCARECROW
5b3h_A2e-584443210377Protein SCARECROW
5b3h_D2e-584443210377Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, root epidermis, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013638736.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893010.0AC189301.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB030D08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638736.10.0PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A397YC940.0A0A397YC94_BRACM; Uncharacterized protein
TrEMBLM4DCN50.0M4DCN5_BRARP; Uncharacterized protein
STRINGBra014251.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40982759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]