PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013638639.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 530aa    MW: 59615.4 Da    PI: 7.8024
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013638639.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.42.2e-12241031297
                     HTT-EE--HHH.HTT....---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3  12 ksgrlvlpkkfaeeh....ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      ++ l +p  f+ +h    +  +   kt +l++  s ++W vk+  ++      lt+GW++F+  ++L+ gD+ +F+++g++ f  +v++f
  XP_013638639.1  24 HTH-LNIPVAFFLKHvqglS--NDHIKTAKLTTdASTKTWLVKV--DGV----RLTDGWEDFAVGHDLRIGDITIFRHEGEMVF--HVTAF 103
                     444.99**********9552..444456666554999*******..555....5***********************9998888..88776 PP

2B359.46.1e-19163251695
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     +++++l+ +rl++p +f +++g+++ ++k+++l +++grsW+++++y+k s +++ + GW++F+ +ng+++g   +Fkl+g +++ +v++
  XP_013638639.1 163 VSPSSLRFDRLYVPISFSRSNGLDNMSGKEIVLLNQEGRSWNLNITYTKASVQTLVGPGWRRFCAENGMNQGHHYTFKLVG-KSAPPVIR 251
                     5677788899*********************************************************************99.67667765 PP

3B359.84.9e-19272361698
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     ++s++l+++ l++ +kf++++g+k  +  +++l++e g +W++ l+y k+ ++++l+ GWk F++ ng+k+gD+++Fk+++ ++ ++v+ +++
  XP_013638639.1 272 ISSNSLRTDKLYIQRKFVNANGLK--GLSEIILKSECGGRWSLGLRYYKSLDHTYLGPGWKTFCQVNGIKTGDSFMFKVVE-TGDKPVLLLCS 361
                     57899999*************988..4559************************************************887.66667887775 PP

4B3491.1e-15430528198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE..EEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE.. CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr..yvltkGWkeFvkangLkegDfvvFkldgr.sefel 92 
                     f+k ++++ +lk+  l+lp  f++ +g++k++  ++tl d++g + +v    +++++   + l+kGW+eF++a+g+k+g +++++l+++ +e+ +
  XP_013638639.1 430 FVKLTLTPRALKTYKLMLPLGFTRVNGINKPG--KITLLDKDGVKKQVVDLLDQNRNIgiMRLGKGWREFCDAHGVKVGQSFLLELIWEdEEAIP 522
                     889999999******************99766..7********6666665565555445699*************************99899999 PP

                     EEEEE- CS
              B3  93 vvkvfr 98 
                     v+k++ 
  XP_013638639.1 523 VLKFCT 528
                     988885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.2E-209108IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.78512106IPR003340B3 DNA binding domain
SuperFamilySSF1019361.29E-1712113IPR015300DNA-binding pseudobarrel domain
CDDcd100179.98E-1313103No hitNo description
SMARTSM010191.6E-1715106IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.9E-19151250IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-17152251IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.916158256IPR003340B3 DNA binding domain
CDDcd100171.69E-13158245No hitNo description
SMARTSM010193.9E-20159256IPR003340B3 DNA binding domain
PfamPF023626.0E-17163251IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-16265360IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.311267362IPR003340B3 DNA binding domain
SMARTSM010193.5E-20268363IPR003340B3 DNA binding domain
SuperFamilySSF1019367.26E-17271361IPR015300DNA-binding pseudobarrel domain
PfamPF023626.3E-17272361IPR003340B3 DNA binding domain
CDDcd100175.59E-14272361No hitNo description
Gene3DG3DSA:2.40.330.109.3E-16423528IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.26E-16426527IPR015300DNA-binding pseudobarrel domain
CDDcd100175.48E-14429519No hitNo description
PROSITE profilePS5086311.702430529IPR003340B3 DNA binding domain
PfamPF023625.6E-15430528IPR003340B3 DNA binding domain
SMARTSM010197.9E-21430530IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MADDQSLRSP MTPHFFQPLL PGFHTHLNIP VAFFLKHVQG LSNDHIKTAK LTTDASTKTW  60
LVKVDGVRLT DGWEDFAVGH DLRIGDITIF RHEGEMVFHV TAFGPSCCDI QYTSASSHNI  120
NDDSQDQTNN TENSSGEKRK RVKKKPRRKE ESSSDHSHFM AHVSPSSLRF DRLYVPISFS  180
RSNGLDNMSG KEIVLLNQEG RSWNLNITYT KASVQTLVGP GWRRFCAENG MNQGHHYTFK  240
LVGKSAPPVI RLSLAEPAPE PSLHHSYYVG SISSNSLRTD KLYIQRKFVN ANGLKGLSEI  300
ILKSECGGRW SLGLRYYKSL DHTYLGPGWK TFCQVNGIKT GDSFMFKVVE TGDKPVLLLC  360
SYNHGKIPLE CSEESDDVNS LSSDTSSGES QESEEENFED EGSSEESFEM VKRENSSRCR  420
ASSSYSQDRF VKLTLTPRAL KTYKLMLPLG FTRVNGINKP GKITLLDKDG VKKQVVDLLD  480
QNRNIGIMRL GKGWREFCDA HGVKVGQSFL LELIWEDEEA IPVLKFCTKL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136145EKRKRVKKKP
2139147KRVKKKPRR
3140146RVKKKPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638639.10.0PREDICTED: B3 domain-containing protein REM17-like
SwissprotQ84WP31e-150REM17_ARATH; B3 domain-containing protein REM17
TrEMBLA0A0D3CDE80.0A0A0D3CDE8_BRAOL; Uncharacterized protein
STRINGBra024695.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57811648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.11e-137B3 family protein