PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013638638.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 536aa    MW: 60319.2 Da    PI: 8.7524
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013638638.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.74.8e-14231011297
                     HTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3  12 ksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      ++ l +p  f+++h  g +k+  kt +l++  s ++W vk+  ++ +    +t+GW++F+ a++L+ gD+++F+++g++ f  +v++f
  XP_013638638.1  23 HTH-LNIPVAFFSKHvqGRNKHI-KTAKLRTyASAKTWLVKI--NGLR----FTDGWEDFAVAHELRIGDIIIFRHEGEMVF--HVTAF 101
                     444.99**********7555544.79****98888*******..5555....9**********************9998888..88776 PP

2B367.91.5e-21160253599
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                      +++++l+ +rl++pk fa ++g+++ ++k+++l +e+grsW+++++y+ ++ +++ + GW++F+ +ng+++g  ++F+l++ +++ +v+++ r+
  XP_013638638.1 160 HVSPSSLSCDRLYVPKGFAMSNGLDNMSGKEIVLLNEEGRSWNLNITYNESGMHTFVRPGWRSFCAENGMNQGHHCTFELVR-KSAPPVLRLSRA 253
                     5678899999*********************************************************************998.888888888775 PP

3B359.94.3e-19274363697
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     ++s++l+++ l+l  kf++++g+kk  s +++le+e+g +W+v l++  +s+r++l+ GWk F++ ng+k+ D+++ kl++ ++ ++v+ ++
  XP_013638638.1 274 VSSNSLRTDKLYLQMKFVAANGLKKGFS-EIILENEWGGRWSVGLRHYASSNRTYLGPGWKTFCQVNGIKAEDSFMVKLVE-TGDKPVLLLC 363
                     57899999****************9887.*************************************************998.5555777776 PP

4B349.57.8e-16440534398
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                       +++ ++lk++   lp  f++ +g++k  +++++l  ++g ++W v l  +k+ g++ ++kGW+e ++a+g+k+g++++++l++++e+ +v+k+
  XP_013638638.1 440 RLTLTQNALKTSVKHLPLGFTRVNGINK--PRKIILLGKDGvKKWVVDLLKNKSTGTMRIRKGWRELCDAHGVKVGESFLLELIWDEEAIPVLKF 532
                     556678888999999*********9996..558********9*******99999999*****************************999999999 PP

                     E- CS
              B3  97 fr 98 
                     + 
  XP_013638638.1 533 CT 534
                     85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.8E-218106IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-199111IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.61711104IPR003340B3 DNA binding domain
CDDcd100172.36E-1412101No hitNo description
SMARTSM010193.8E-2114104IPR003340B3 DNA binding domain
PfamPF023621.2E-82598IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-21149250IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-20150250IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.72156254IPR003340B3 DNA binding domain
CDDcd100177.94E-17156243No hitNo description
SMARTSM010196.4E-28157254IPR003340B3 DNA binding domain
PfamPF023621.3E-19160253IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-15266365IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.324269365IPR003340B3 DNA binding domain
SMARTSM010196.1E-18270366IPR003340B3 DNA binding domain
SuperFamilySSF1019361.22E-15273366IPR015300DNA-binding pseudobarrel domain
PfamPF023621.0E-17274364IPR003340B3 DNA binding domain
CDDcd100176.12E-14275363No hitNo description
Gene3DG3DSA:2.40.330.107.6E-16434534IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-16434533IPR015300DNA-binding pseudobarrel domain
CDDcd100177.57E-14436533No hitNo description
PROSITE profilePS5086312.576438535IPR003340B3 DNA binding domain
PfamPF023624.1E-15438534IPR003340B3 DNA binding domain
SMARTSM010191.9E-20438536IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MAHQSLHSPT NPHFFQPLLP GFHTHLNIPV AFFSKHVQGR NKHIKTAKLR TYASAKTWLV  60
KINGLRFTDG WEDFAVAHEL RIGDIIIFRH EGEMVFHVTA FGPSCCDIQY TSASSHNIID  120
DSQDQANNTG NSSGEKRKRV KKNPRTKEES SSDHSHFVAH VSPSSLSCDR LYVPKGFAMS  180
NGLDNMSGKE IVLLNEEGRS WNLNITYNES GMHTFVRPGW RSFCAENGMN QGHHCTFELV  240
RKSAPPVLRL SRAEHDPKLA PESSLHHSYY VGSVSSNSLR TDKLYLQMKF VAANGLKKGF  300
SEIILENEWG GRWSVGLRHY ASSNRTYLGP GWKTFCQVNG IKAEDSFMVK LVETGDKPVL  360
LLCTSNRGKT PLECSEDSDD VNSLSSDTSS GDDSGEESQE SEEESLEDDS SSKDCVEMEK  420
RKRSLRCKYP SSYSKHRFVR LTLTQNALKT SVKHLPLGFT RVNGINKPRK IILLGKDGVK  480
KWVVDLLKNK STGTMRIRKG WRELCDAHGV KVGESFLLEL IWDEEAIPVL KFCTKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638638.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X2
SwissprotQ84WP31e-154REM17_ARATH; B3 domain-containing protein REM17
TrEMBLA0A0D3CDE70.0A0A0D3CDE7_BRAOL; Uncharacterized protein
STRINGBra024696.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.11e-149B3 family protein