PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013638352.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 400aa    MW: 43547 Da    PI: 6.3751
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013638352.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573119.41.8e-37151242297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     +fqr+wseeDei++LqGlid++++tg+sp+dd++afy  vkksisf+vsk+q+++Ki  LK K++++  k    +e +fsk+hd+k+f+lsk +W
  XP_013638352.1 151 YFQRVWSEEDEIAVLQGLIDYRNDTGASPYDDTNAFYLSVKKSISFDVSKTQVIKKIWGLKTKYENNLGK----EELTFSKPHDRKAFDLSKFVW 241
                     79********************************************************************....9******************** PP

          DUF573  97 g 97 
                     g
  XP_013638352.1 242 G 242
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.0E-31152242IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MSGKRFNPLE DPPSASSSDE DDQVKTTSLA GNSSSEDETD DESSKNPSSN KPESAPEKQQ  60
VSNSESGSDE ETDSDSQTVR VKKNPGSSSD ANKSIAGTKD SAVVKNHDSK KVKPLTKKRS  120
LSETDGAAAA ASKEAKKVKS GGSGEEAKKT YFQRVWSEED EIAVLQGLID YRNDTGASPY  180
DDTNAFYLSV KKSISFDVSK TQVIKKIWGL KTKYENNLGK EELTFSKPHD RKAFDLSKFV  240
WGADAAALDS AVKSNGKSKK SSKSKVEPEK VALDSANGKS KKSSKSSSKK VEPEKQELAS  300
SSSPNGKSCE EEAMTNKGEA SSVVEVDAFD KSVLVKALAR FGVDDLSAQQ GWSRLALEDK  360
KRFEEEWKTL QLRELEFYSK KSGFIHEVIT KMAESFPPNP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638352.10.0PREDICTED: mediator-associated protein 1
TrEMBLA0A0D3C9B90.0A0A0D3C9B9_BRAOL; Uncharacterized protein
STRINGBra019847.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.12e-61DNA-binding storekeeper protein-related transcriptional regulator