PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013637529.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 477aa    MW: 52416.9 Da    PI: 7.211
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013637529.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.81.9e-32165222260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkve s  d++++ei+Y+g+Hnh+k
  XP_013637529.1 165 EDGYNWRKYGQKQVKGSENPRSYYKCTYPSCPTKKKVEMSL-DGQITEIVYKGSHNHPK 222
                     7****************************************.***************85 PP

2WRKY1062e-33320378159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  XP_013637529.1 320 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTTGCPVRKHVERASHDMRAVITTYEGKHNHD 378
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.6E-27159223IPR003657WRKY domain
SuperFamilySSF1182901.96E-24164223IPR003657WRKY domain
SMARTSM007748.9E-34164222IPR003657WRKY domain
PROSITE profilePS5081122.561165223IPR003657WRKY domain
PfamPF031068.4E-25165221IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.2E-37305380IPR003657WRKY domain
SuperFamilySSF1182902.09E-29312380IPR003657WRKY domain
PROSITE profilePS5081138.595315380IPR003657WRKY domain
SMARTSM007745.5E-39320379IPR003657WRKY domain
PfamPF031067.9E-26321378IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MAASSLLTMD NNRTRQNMNG SVNWSQQTSR ASPASLEDLE IPPKFRSFAP SSISTSPSTC  60
FSPSVFLDSP AFVSSSANVL ASPTTGALIT NESDHKSITE EEKTNNNNNS LSLFDFSFQT  120
QPSGVSAPTT TTNSSVLQWS QTDTRPNNNT HQAVPYNGRE QRKGEDGYNW RKYGQKQVKG  180
SENPRSYYKC TYPSCPTKKK VEMSLDGQIT EIVYKGSHNH PKPQSTRRSS SSFSTFHSGG  240
LDHHGSSDSF AIQQEDNATS GSLGDDELSV ISREEEDYGS EPEAKRWKGE NETNGGSGNG  300
SKTVREPRIV VQTTSDIDIL DDGYRWRKYG QKVVKGNPNP RSYYKCTTTG CPVRKHVERA  360
SHDMRAVITT YEGKHNHDVP AARGSGYSTN RLAQDPSSAP IRPNAIAGHS HYTTSSQAPY  420
TLQMLQHNNN TNAGPFGYAM NNNIQTQQNN FVGGGFSIAK EEPNEESSSS FFDSFLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-38165381878Probable WRKY transcription factor 4
2lex_A9e-38165381878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931480.0KM593148.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY54) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013637529.10.0PREDICTED: probable WRKY transcription factor 33
RefseqXP_013701889.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P50.0WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A078JWQ80.0A0A078JWQ8_BRANA; BnaCnng66020D protein
TrEMBLA0A0D3C4Z70.0A0A0D3C4Z7_BRAOL; Uncharacterized protein
STRINGBra017117.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.10.0WRKY DNA-binding protein 33