PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013636978.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 702aa    MW: 79481.7 Da    PI: 6.6427
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013636978.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS361.11.5e-1103276971371
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cA+avss+d ++a+ lL ++++++s++gd ++Rla+y++  L+arla++++++y al++++ts    s+ l+a++++  v+P+ k + 
  XP_013636978.1 327 LRTLLVSCAQAVSSNDRKMAEDLLRQVRQHSSSHGDGTERLAHYLADSLEARLAGTGTQIYTALSSKKTS---ASDMLKAYQTYISVCPFKKTAI 418
                     6789**************************************************************9999...9********************* PP

            GRAS  96 ltaNqaIleavege.ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                     + aN+ I+  + ++ +++HiiDf+is+G+QWp+L++ La R++g+ +lRiTg++ p+ g   +e ++etgerLa+++++ +vpfe+n  +a+++e
  XP_013636978.1 419 IFANHSIMHLAPTDaKTIHIIDFGISYGFQWPPLIHRLAWRRGGSCKLRITGIELPQRGfrPAEGVNETGERLARYCQRYNVPFEYNG-IAQKWE 512
                     *********99888799****************************************99*****************************.7***** PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     +++le+L++++gE +aVn+ ++  +llde+v+++s+rd+vLkl+k+++P+v++ +     +n++ F++rf e l +ys+lfd+ +++lpr +  r
  XP_013636978.1 513 TIKLEDLKLREGEFVAVNSLFRFRNLLDETVAVHSPRDAVLKLIKKIKPDVFIPAVLSGCYNAPFFVTRFREVLFHYSSLFDMCDTSLPRGDPMR 607
                     *********************************************************************************************** PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvS 371
                     i+ E+e+ grei+nvvaceg+er+er e++++W++r ++aGF++++l+++ +++ kl+++  + s+++ v+++ ++l++gWk+r +++ +
  XP_013636978.1 608 IMFEKEFYGREIMNVVACEGSERVERPESYKQWQARAMRAGFRQLTLEKELVQKLKLMVESGYrSKEFDVDQDGNWLLQGWKGRIVYASC 697
                     ************************************************************99999********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.111301679IPR005202Transcription factor GRAS
PfamPF035145.4E-108327697IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MGSYSAGFPG SFDNFDFNFG DGFYLDDQPL LEIPSPFPPP PPAPPHPDPY SHAADAESDF  60
SDSVLKYISQ VLMEEDMEEK PCMFHDALSL QAAEKSLYEA LGQKYPDHSE RLAHSPDGSS  120
PGYASSTTSS DWSFDCLENN RPSWLHSPIS NNFVFQSTRS NPKPSGGSNV ALKSSFNNDL  180
VSNMFNDSEL AFQFKRGKEE ASKFLPKSSQ LVIDLESYIP ANDPKEHPSV LPYRRTGKKK  240
HWREDEHLVS EERSKKQSAV YVDEAELSEM FDKILLFGRP KEQPLCILND NFIKETAKDS  300
SSSYKSDATQ QKHAASGNSY AKETPDLRTL LVSCAQAVSS NDRKMAEDLL RQVRQHSSSH  360
GDGTERLAHY LADSLEARLA GTGTQIYTAL SSKKTSASDM LKAYQTYISV CPFKKTAIIF  420
ANHSIMHLAP TDAKTIHIID FGISYGFQWP PLIHRLAWRR GGSCKLRITG IELPQRGFRP  480
AEGVNETGER LARYCQRYNV PFEYNGIAQK WETIKLEDLK LREGEFVAVN SLFRFRNLLD  540
ETVAVHSPRD AVLKLIKKIK PDVFIPAVLS GCYNAPFFVT RFREVLFHYS SLFDMCDTSL  600
PRGDPMRIMF EKEFYGREIM NVVACEGSER VERPESYKQW QARAMRAGFR QLTLEKELVQ  660
KLKLMVESGY RSKEFDVDQD GNWLLQGWKG RIVYASCTLV PT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-413246542328GRAS family transcription factor containing protein, expressed
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1233239RRTGKKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013636978.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636977.10.0PREDICTED: scarecrow-like protein 33
RefseqXP_013636978.10.0PREDICTED: scarecrow-like protein 33
SwissprotP0C8830.0SCL33_ARATH; Scarecrow-like protein 33
TrEMBLA0A0D3BTY60.0A0A0D3BTY6_BRAOL; Uncharacterized protein
STRINGBo4g065860.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein