PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013636674.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 654aa    MW: 72629.7 Da    PI: 7.1146
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013636674.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093824191954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_013636674.1 382 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 419
                     554459******************************88 PP

2BELL120.57.2e-39245316172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL s+l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+Fr+Lk+aia+qi
  XP_013636674.1 245 ERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRSLKEAIAGQI 316
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.4E-66173314IPR006563POX domain
PfamPF075266.5E-45179313IPR006563POX domain
PROSITE profilePS5007112.26360423IPR001356Homeobox domain
CDDcd000862.87E-12363424No hitNo description
SMARTSM003892.3E-9363427IPR001356Homeobox domain
SuperFamilySSF466895.99E-17364430IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-29366429IPR009057Homeodomain-like
PfamPF059202.7E-18380419IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MIMKHVHPQI SINPEISAGS DGSLQTLILM NPTTYVQYTQ QDDDSNNNNN NSNNTNNNNS  60
FVFLNSHAPP QNASQQFIGI PLSGHEAASI TSADSISVLQ GYPPRVKYSH YSSHQVDSSH  120
QQAACETPRA HQGLFLTLSS QQQQQQHQNQ HQTFHHVGLG PGPGQNMRVG SGSTGIATLV  180
SSKYLEAAQE LLDEVVKADS NDINTRSQLF SSKKGTNETD NKAVGESSGG GEASEKNKVE  240
LGTVERQEIQ MKKAKLSSML HEVEQRYRQY HQQMQMVISS FEQAAGIGSA KSYTSLALKT  300
ISRQFRSLKE AIAGQIKAAN NSLGEEDSVS GVGRLKFVDH QLRQQRALQQ LGMIQHHPSN  360
NAWRPQRGLP ERAVSVLRAW LFEHFLHPYP KDSDKHMLAK QTGLTRSQVS NWFINARVRL  420
WKPMVEEMYV EEMKEQGKNM GSMEKTPNLD QNNEDSASKS ASNQEKSPMG GRGVDNYHLN  480
PNQNGELEGV TGMQGSPKRL RTNEETMMQP NVDFTSNEKL TMKILEERQE IRSDGGYPFM  540
GNFGQYQMDE MSRFDVAVSD QELLAQRYSG NNNGVSLTLG LPHCDSLSST RHQGFMQTHH  600
GIPIGRRVKI GETEEYGAAN ISAATVHSSA AAYSAMNIQN QKRYVAQLLP DFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B1e-16369427563Homeobox protein Meis2
3k2a_A1e-16369427563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893800.0AC189380.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB050K06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636674.10.0PREDICTED: BEL1-like homeodomain protein 1 isoform X1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0D3BRP70.0A0A0D3BRP7_BRAOL; Uncharacterized protein
STRINGBra005310.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]