PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013636083.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family VOZ
Protein Properties Length: 389aa    MW: 43806.6 Da    PI: 7.8483
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013636083.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ414.32.2e-1271283421215
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     pppsaflgpkcalwdctrpa+gs+w+ dycs +h +lalne++pgt+pvlrp+gi+lkd+ll++al+ak+ gk+vgip+cega+++k+pw+aael
  XP_013636083.1 128 PPPSAFLGPKCALWDCTRPAHGSDWYLDYCSDYHGNLALNEDSPGTAPVLRPGGISLKDNLLIDALRAKTLGKNVGIPVCEGAVNTKCPWKAAEL 222
                     89********************************************************************************************* PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklv 190
                     f+l+l+egetirewlffdkprra++sgnrkqrslpdysgrgwhesrkq+mke++g+krsyymdpqp++ fewhl+ey+ine+d +alyrlelk++
  XP_013636083.1 223 FHLELVEGETIREWLFFDKPRRAYDSGNRKQRSLPDYSGRGWHESRKQLMKEQEGQKRSYYMDPQPPGLFEWHLFEYQINESDVCALYRLELKVT 317
                     *********************************************************************************************** PP

             VOZ 191 dekksakgkvskdsladlqkklgrl 215
                     ++kks+kg+v+kd+ladlqkk+ ++
  XP_013636083.1 318 NGKKSPKGRVAKDPLADLQKKMEKM 342
                     *********************9886 PP

Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MSNHEKITCV STSHQNLVEK LMQLQERFSH LQAARKEGRV GDHAVLEAQI SQNLREWQAE  60
LTAPSPEPSL LVRKSWTLVD HSNLDITSQL DYHLSEVRQE FNNSPSVKLD ASENYTDFTT  120
PQSVRVPPPP SAFLGPKCAL WDCTRPAHGS DWYLDYCSDY HGNLALNEDS PGTAPVLRPG  180
GISLKDNLLI DALRAKTLGK NVGIPVCEGA VNTKCPWKAA ELFHLELVEG ETIREWLFFD  240
KPRRAYDSGN RKQRSLPDYS GRGWHESRKQ LMKEQEGQKR SYYMDPQPPG LFEWHLFEYQ  300
INESDVCALY RLELKVTNGK KSPKGRVAKD PLADLQKKME KMGQLTPEVA SDKPSPPTKG  360
RTKATKGVKL ATQDTPVPAT VAKEPLSHQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles and mesophyll cells of various tissues. Expressed in the root, especially in the root tip. Also detected in stamen filaments, stipules and anthers. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ1 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Binds as a dimer to the palindromic sequence 5'-GCGTNNNNNNNACGC-3'. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013636083.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. Down-regulated by far-red light (at protein level). {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636082.10.0PREDICTED: transcription factor VOZ2-like
RefseqXP_013636083.10.0PREDICTED: transcription factor VOZ2-like
RefseqXP_013636084.10.0PREDICTED: transcription factor VOZ2-like
SwissprotQ9SLB91e-179VOZ2_ARATH; Transcription factor VOZ2
TrEMBLA0A0D3C5T60.0A0A0D3C5T6_BRAOL; Uncharacterized protein
STRINGBo4g191510.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.10.0vascular plant one zinc finger protein 2
Publications ? help Back to Top
  1. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  2. Koguchi M,Yamasaki K,Hirano T,Sato MH
    Vascular plant one-zinc-finger protein 2 is localized both to the nucleus and stress granules under heat stress in Arabidopsis.
    Plant Signal Behav, 2017. 12(3): p. e1295907
    [PMID:28277968]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]