PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013635683.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 238aa    MW: 27162.8 Da    PI: 8.4562
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013635683.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.64.3e-201662349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     e + n qvtfskRr+g++KKA+EL++LC++   vi+fs+ +k++ +
  XP_013635683.1 16 MEKDANLQVTFSKRRQGLFKKASELCTLCNVGMGVIVFSPGQKVFSF 62
                    688999*************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.5E-28665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.343666IPR002100Transcription factor, MADS-box
CDDcd002655.71E-31780No hitNo description
SuperFamilySSF554552.22E-25787IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-16828IPR002100Transcription factor, MADS-box
PfamPF003194.7E-221562IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-162843IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-164364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MPRSTGGRKK IPIEKMEKDA NLQVTFSKRR QGLFKKASEL CTLCNVGMGV IVFSPGQKVF  60
SFGNPDVKSV IDNFKNHNHS PLLYTQDGLN PTIQNLNSLL TQELTILEME KKRKKELDEI  120
KNKREEIEKW WEKSPNQLDL SQNTCLTRAL ENLKMELVSQ RSQQLQAIDP PNYYGESYNN  180
IVGGGNVDLF DQTSMFDGNA SNYNPNMIIS NHGPMVENNH KTNVFEAFRP RSNLNLPE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110114KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635683.11e-178PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A078FRI91e-166A0A078FRI9_BRANA; BnaC04g15630D protein
TrEMBLA0A0D3BU381e-166A0A0D3BU38_BRAOL; Uncharacterized protein
STRINGBra011938.1-P1e-156(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16574611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.17e-60AGAMOUS-like 62