PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013635570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 240aa    MW: 27909.1 Da    PI: 9.967
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013635570.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.81.6e-191762449
                    -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    e +s  qvt+skRr+g++KKA+EL++LC++e+ +++fs+  k++ +
  XP_013635570.1 17 EKDSDLQVTYSKRRQGLFKKASELCTLCGVEIGILVFSPGRKVFSF 62
                    667788*********************************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.876666IPR002100Transcription factor, MADS-box
SMARTSM004327.7E-29665IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-24781IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-16828IPR002100Transcription factor, MADS-box
PfamPF003193.8E-221562IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-162843IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-164364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MARSRKGRRK IQIVKMEKDS DLQVTYSKRR QGLFKKASEL CTLCGVEIGI LVFSPGRKVF  60
SFGNPDVRYV FNRFKIYHQN PFQLTEFGPS ATIRDLNSIL SQELVKLEKE KARRKILEKI  120
RIQREETDKW WEKPPSELNL RQNACLVSVL ENLRMNLGSP RFQQAMVPQN YCGGSNNNIV  180
GGGNTDPLDE RSMFDVNAFN YNPNMMIPNQ GPMLGYNNIK FEVFDPIYNM NWPEYKHGPY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635570.11e-180PREDICTED: agamous-like MADS-box protein AGL62 isoform X1
SwissprotQ9FKK21e-62AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A0D3C2M41e-180A0A0D3C2M4_BRAOL; Uncharacterized protein
STRINGBra035685.1-P1e-138(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16574611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36590.14e-60M-type_MADS family protein