PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013634181.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family FAR1
Protein Properties Length: 185aa    MW: 21638.7 Da    PI: 9.6411
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013634181.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR185.86.8e-2726114290
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     fY++Y++++GF +r+ + ++s+r+g++  r+f C+keg+  + + k+ + r++r++tr gCka+++vk +++gkw+vtk+++eHnH+l+
  XP_013634181.1  26 FYDDYSRSLGFVMRVMSCRRSERDGRVLARRFGCNKEGRCVSVRGKSGSVRKPRQSTREGCKAMVHVKYDRSGKWVVTKFVKEHNHPLV 114
                     9**************************************99999999****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.6E-2426114IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MAVEDDSTIV PREGTEFESE EAAKMFYDDY SRSLGFVMRV MSCRRSERDG RVLARRFGCN  60
KEGRCVSVRG KSGSVRKPRQ STREGCKAMV HVKYDRSGKW VVTKFVKEHN HPLVVEPRQA  120
RQTLDEKDKR IQELTIELRN KKRLCAAYKE QLDAFAKIVE EYSNRMSKRV ESVVENLKEF  180
EHIEQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013634181.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634181.11e-135PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X1
RefseqXP_013690533.11e-135protein FAR1-RELATED SEQUENCE 5 isoform X1
SwissprotQ9SZL82e-23FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A3P6D6M41e-133A0A3P6D6M4_BRAOL; Uncharacterized protein
STRINGBo4g194230.11e-132(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39182855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-118FAR1 family protein
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]