PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013633898.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 725aa    MW: 82389 Da    PI: 6.8231
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013633898.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS362.18e-1113497221373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lLl+cA+avs +d+++a+ lL  +++++s++gd ++Rla+yf++ L+arla++++++y al++++ts    ++ l+a+++++ v+P+ k++ 
  XP_013633898.1 349 LRSLLLSCAQAVSVNDHRRAEGLLRLVRQHSSSYGDGTERLAHYFANSLEARLAGTGTQVYTALSSKKTS---AADMLKAYQTYVSVCPFKKIGI 440
                     689***************************************************************9999...9********************* PP

            GRAS  96 ltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                     + aN++I + v++   +++HiiDf+is+G+QW +L + La R++++ +lRiTg++ p+ g   ++ + etg+rLak++++++vpfe+n+ +a+++
  XP_013633898.1 441 VFANHTIQQLVKKTmpNTIHIIDFGISYGFQWHSLVHRLAWRRGSSCKLRITGIDLPQRGfrPANGVIETGHRLAKYCKKFNVPFEYNA-IAQKW 534
                     **************999*****************************************9999***************************.7**** PP

            GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                     e+++le+L++k+gE +aVn+ ++  +llde+v+++s+rd vL+l+++++P++++ +    ++n++ F++rf e l+++s+lfd+ +++l re+  
  XP_013633898.1 535 ETIKLEDLKLKEGEFVAVNSLFRFRNLLDETVAVDSPRDVVLRLIQKIKPNIFIPSILSGSYNAPFFVTRFREVLYHFSSLFDMCDTTLTREDPM 629
                     *********************************************************************************************** PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                     r++ E+e+ grei+nvvaceg++r+er e++++W+ r+ +aGF+++p++++ +++ +l++ k + s+++ v+++ +++++gWk+r +++ S+W
  XP_013633898.1 630 RVVFEKEFYGREIMNVVACEGTARVERPESYKQWQGRMVRAGFRQLPVEKELVQKLRLMVDKEYkSKEFDVDQDGNWFLQGWKGRLVYASSFW 722
                     ************************************************************9998899************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.897323702IPR005202Transcription factor GRAS
PfamPF035142.8E-108349722IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
MGSYSAGFPG SFDNFHFNCK IDFSNLGNGL YLDDQPFLRS PSPFPPLPLP PLHPPPHPEP  60
YSQQNLHAAD ADADVDADDD CTDSVLQYIS QVLMEEDMDD KPCMFHDALS LQAAERSLYE  120
ALGEKYPDST SPIQLAHNPD ELSDITSSGY TSRTTTTTTT SSDWSFDSLE NSRPSWMQTS  180
IPKNFVFQST PSTRSSPTSG RNTGIRSSSS NDLVSNMFKD SSWALQFKKG VEEASKFLPK  240
STQLVIDVEN DHHYVPYRIT GEKCHWREDE HLPEERNKKQ SAVYADDPEL SEMFDKILLF  300
GDPKENPKCI LNETSQKEPP KASPSPKGET TTYPRGQKPT AYVKEIPDLR SLLLSCAQAV  360
SVNDHRRAEG LLRLVRQHSS SYGDGTERLA HYFANSLEAR LAGTGTQVYT ALSSKKTSAA  420
DMLKAYQTYV SVCPFKKIGI VFANHTIQQL VKKTMPNTIH IIDFGISYGF QWHSLVHRLA  480
WRRGSSCKLR ITGIDLPQRG FRPANGVIET GHRLAKYCKK FNVPFEYNAI AQKWETIKLE  540
DLKLKEGEFV AVNSLFRFRN LLDETVAVDS PRDVVLRLIQ KIKPNIFIPS ILSGSYNAPF  600
FVTRFREVLY HFSSLFDMCD TTLTREDPMR VVFEKEFYGR EIMNVVACEG TARVERPESY  660
KQWQGRMVRA GFRQLPVEKE LVQKLRLMVD KEYKSKEFDV DQDGNWFLQG WKGRLVYASS  720
FWVSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-433477223374GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013633898.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013633897.10.0PREDICTED: scarecrow-like protein 33
RefseqXP_013633898.10.0PREDICTED: scarecrow-like protein 33
SwissprotP0C8830.0SCL33_ARATH; Scarecrow-like protein 33
TrEMBLA0A0D3C2S50.0A0A0D3C2S5_BRAOL; Uncharacterized protein
STRINGBo4g168030.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein