PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013633750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 407aa    MW: 46557.9 Da    PI: 4.3698
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013633750.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57391.59.5e-2975169397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                      ++ w+++De+++L  ++d++++t+ s  +d+dafy +vk+ i+ ++sk+ql++Kir+L k+f +++++ ++++ psf+ ++d+ if+ls +iW+
  XP_013633750.1  75 NKMNWTKDDELIILGSIVDYEKETKLSHRSDWDAFYGYVKDFIEPDFSKKQLTDKIRNLNKRFLGNKARCDDEEGPSFTDTEDDIIFKLSVIIWD 169
                     5799******************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.5E-2277169IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MKIRVFSLPQ PKFRSLIHRN QMALGKRTRD YDSNDKPISS SPLRRMQEDD ASGMESMLRR  60
RKQPKTTPVS SSSNNKMNWT KDDELIILGS IVDYEKETKL SHRSDWDAFY GYVKDFIEPD  120
FSKKQLTDKI RNLNKRFLGN KARCDDEEGP SFTDTEDDII FKLSVIIWDS TNETGCASDE  180
NVDQAKDVPC VENEPVDENM DPAKDLPCVE DERVDENVDQ AKALDLDKDA PCVERERVNE  240
NMDLDQEKDV PCVEHELVNE NMDQEQAVLC TGDEPMSNAS IETDKGEKDG VDEFCALKDA  300
LTDKEEKEKS TEDVGDELCA MKDALTDKEK SEDVYCALKD ALEETTFFQS IGKYQQKVLL  360
QNLKNLRGTR RKELADELKE LLNEEMKVRA KKLSLTAKLA SAWEESC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013633750.10.0PREDICTED: uncharacterized protein LOC106339475 isoform X2
TrEMBLA0A0D3C4K20.0A0A0D3C4K2_BRAOL; Uncharacterized protein
STRINGBra017244.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36340.15e-69DNA-binding storekeeper protein-related transcriptional regulator