PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013633564.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 676aa    MW: 73590.5 Da    PI: 6.9947
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013633564.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093944311954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_013633564.1 394 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 431
                     554459******************************88 PP

2BELL123.58.7e-40253324172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqe+q+kkakL s+l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
  XP_013633564.1 253 ERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKLYTSLALKTISRQFRCLKEAIAGQI 324
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.2E-78173322IPR006563POX domain
PfamPF075264.1E-47179321IPR006563POX domain
PROSITE profilePS5007112.26372435IPR001356Homeobox domain
CDDcd000863.03E-12375436No hitNo description
SMARTSM003892.3E-9375439IPR001356Homeobox domain
SuperFamilySSF466895.99E-17376442IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-29378441IPR009057Homeodomain-like
PfamPF059202.8E-18392431IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MAAYFHGNPS EISAGTDGGL QTLILMNPTT YVQYTQQDDD SNNNNNSNNN ANNNNSFVFL  60
DSHAPPQNAS QQFVGIPLSG HEAASITAAD NISVLHGYPP RVQYSLYNSH QVDPTHQQAA  120
CETPRAQRGL SLSLSSQQQQ QQQQHQTLHH VGFGSGPGED IRVGPGSTGS GVTNGIANLV  180
SSKYLKAAQE LLDEVVNADS KDINTKSQLF SSKKGTSGTD NKAVGESSTG AGEGSGGGGE  240
ASGKRTVELG TAERQEIQMK KAKLSSMLHE VEQRYRQYHQ QMQMVISSFE QAAGIGSAKL  300
YTSLALKTIS RQFRCLKEAI AGQIKAANKS LGEEDSVSGV GRLEGSRLKF VDHHLRQQRA  360
LQQLGMIQHP SNNAWRPQRG LPERAVSVLR AWLFEHFLHP YPKDSDKHML AKQTGLTRSQ  420
VSNWFINARV RLWKPMVEEM YTEEMKEQGK NMGSMEKTLN MDQNNEDSAS KSTSNQEKSP  480
MGGGGGADNY HMNPNHNGDL EGVTGMQGSP KRLRTSEETM MQPINADFSS NEKLTMKILE  540
ERQGLRSDGG YPFMGNFGQY QMDEMSRFEV AVSDQELLAQ RYSGNNNGVS LTLGLPHCDS  600
LSSTHHQGFM QTHHGIPIGR RVKIGEADDY GAAALNGGGG SAATVHSSAA AAAAYNGMNI  660
QNQKRYVAQL LPDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-17381438158Homeobox protein Meis1
4xrs_B5e-17381438158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013633564.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_013633565.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0D3C4G60.0A0A0D3C4G6_BRAOL; Uncharacterized protein
STRINGBra017277.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1