PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013633151.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 332aa    MW: 38358 Da    PI: 6.4987
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013633151.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF633.3e-201765250
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    +++++s + +++  R+ +i+KKA+EL +LCd+e++vi ++++g++++++
  XP_013633151.1 17 SSSSYSLAATSLKSRLLTIFKKAQELTTLCDIEACVIHYGPDGEMRTWP 65
                    799*********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500668.9282668IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.29E-1328100IPR002100Transcription factor, MADS-box
PfamPF003192.8E-103064IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MRSPRSSSCS KCSSSSSSSS YSLAATSLKS RLLTIFKKAQ ELTTLCDIEA CVIHYGPDGE  60
MRTWPENRDI VRSLALRYIQ LDQAKRRKKS VNLYEFLNKN KEKKKMIDNF KKAKRNVEEL  120
KYPISDHYTP DQINQLIHSL ELSYSKLQER RRFLAAKANL DDRQHSLNPN HFTKYPQESC  180
VYDQNNNNYN FQHLCLSDYS TLHYQLMPYG GSDQNMMCMV NNFQHPCVSS NTTDYSVFPL  240
ELQESVSNYE LNQLMPHELN YGFDQNMCMA DTTNSCNVED PCLSDDFCFD FQDPYSGFMV  300
GNPSFSHDFN PVMSSSYVDE NRLLQASTLP SL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013633151.10.0PREDICTED: uncharacterized protein LOC106338804
SwissprotQ9FLL05e-60AGL75_ARATH; Agamous-like MADS-box protein AGL75
TrEMBLA0A0D3C0090.0A0A0D3C009_BRAOL; Uncharacterized protein
STRINGBra025607.1-P1e-154(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41200.15e-58AGAMOUS-like 75