PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013633147.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 178aa    MW: 20554.3 Da    PI: 10.0883
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013633147.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.63.4e-181866250
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    +++ +s + +++  R+ +i+KKA+EL +L d+e++vi ++++g+l++++
  XP_013633147.1 18 SSSTYSLAPTSLNSRLLTIFKKAQELTTLSDIEACVIHYGPDGELRTWP 66
                    6788999*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554557.19E-1330101IPR002100Transcription factor, MADS-box
PfamPF003191.1E-83265IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MRSPRPSSCS ESSSSSSSSS TYSLAPTSLN SRLLTIFKKA QELTTLSDIE ACVIHYGPDG  60
ELRTWPENRD IVRDLALRYI QLDEAKRRKK NVNLYEFLNK NKDKKKMANN FKKKAKKNVE  120
ELKYPISDHY SPDEINQLIH SLELSYSTLQ ERRRFLAAKK HNESLNPSQF TPYHKSLG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013633147.11e-129PREDICTED: agamous-like MADS-box protein AGL93
RefseqXP_013645726.11e-129PREDICTED: agamous-like MADS-box protein AGL93
SwissprotQ9FIX02e-52AGL81_ARATH; Agamous-like MADS-box protein AGL81
TrEMBLA0A078JD851e-126A0A078JD85_BRANA; BnaCnng47860D protein
TrEMBLA0A0D3BZX91e-126A0A0D3BZX9_BRAOL; Uncharacterized protein
STRINGBra025609.1-P3e-83(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G38740.12e-46AGAMOUS-like 77