PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013632192.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 142aa    MW: 16628.1 Da    PI: 6.3638
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013632192.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.24.3e-4264141178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqve+C+ad+s+ak+yh+rhkvCe+h+kap v +sgl qrfCqqCsrfhelsefD++krsCrrrLa+hnerrr++++
  XP_013632192.1  64 ACQVERCTADMSRAKQYHKRHKVCEFHAKAPLVRISGLYQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRRNTT 141
                     5*************************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375751.6E-561142IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.3E-3258126IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.82962139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.18E-3764140IPR004333Transcription factor, SBP-box
PfamPF031104.6E-3265138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MSTRRSRAEG KRSLREMSEE EEEDEEDEET FEGEEDEDTS EEEEAVEKKQ KGKATTSSSS  60
GTGACQVERC TADMSRAKQY HKRHKVCEFH AKAPLVRISG LYQRFCQQCS RFHELSEFDD  120
TKRSCRRRLA GHNERRRRNT TQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3956138284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013632192.13e-98PREDICTED: squamosa promoter-binding-like protein 3
SwissprotP930156e-61SPL3_ARATH; Squamosa promoter-binding-like protein 3
TrEMBLA0A078HK583e-72A0A078HK58_BRANA; Squamosa promoter-binding-like protein
STRINGBra021880.1-P5e-71(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-47squamosa promoter binding protein-like 3