PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013632080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 204aa    MW: 23482.6 Da    PI: 7.0173
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013632080.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.21.4e-1321971096
                    HHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3 10 vlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                     ++++ l +p  f+ +h + +++ kt +l++  s  +W+v++  ++++    l++GW++F+  ++L+ gD+v+F+++g+    lv++v
  XP_013632080.1 21 GFTNH-LDIPVAFFLKHLERNNKRKTAKLRSdASETTWRVEI--DGQR----LSDGWEDFAVGHDLRLGDIVIFRHEGE----LVFHV 97
                    56666.9**********444456779999986889*******..9888....***********************7664....44443 PP

2B332.31.8e-10142198159
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgry 59 
                     ff +++++++lk+++++lpk+fa ++g+ k   ++++l++e+g+sW++ l+y+ ++gr+
  XP_013632080.1 142 FFMTTVTASNLKRDIVYLPKTFAMSNGLMK--RFEIVLMNEEGESWKIGLTYESCRGRF 198
                     788899********************9995..579***************998888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.34E-199109IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.9E-209104IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.05311103IPR003340B3 DNA binding domain
CDDcd100172.51E-151298No hitNo description
SMARTSM010192.6E-1814103IPR003340B3 DNA binding domain
PfamPF023622.6E-82496IPR003340B3 DNA binding domain
SuperFamilySSF1019361.88E-9137196IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.3E-10137196IPR015300DNA-binding pseudobarrel domain
PfamPF023621.7E-7142198IPR003340B3 DNA binding domain
PROSITE profilePS508638.261142204IPR003340B3 DNA binding domain
SMARTSM010190.23142202IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MANSPLHSPI NPHFFQPLLP GFTNHLDIPV AFFLKHLERN NKRKTAKLRS DASETTWRVE  60
IDGQRLSDGW EDFAVGHDLR LGDIVIFRHE GELVFHVTAL GPSCSEIQYG GYSDEEEDKK  120
EKVSRKKKSP NAETDHSTDQ SFFMTTVTAS NLKRDIVYLP KTFAMSNGLM KRFEIVLMNE  180
EGESWKIGLT YESCRGRFCR HQIY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013632080.11e-154PREDICTED: B3 domain-containing protein REM10-like
SwissprotP0DH851e-89REM10_ARATH; B3 domain-containing protein REM10
TrEMBLV4LRL31e-104V4LRL3_EUTSA; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_40003921e-90(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144901522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.12e-83B3 family protein