PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013632002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 409aa    MW: 44855 Da    PI: 5.8543
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013632002.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS358.97.5e-110464042374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsPilkfs 94 
                      +lLl+cAe v++++l++a+ lL+++se++sp g++ +R++ayf++AL+ar+ +  + l+ a+++s+ se+   s++ +aal++f+ +sP++kfs
  XP_013632002.1  46 LSLLLQCAEYVATDHLREASILLSEISETCSPFGSSPERVVAYFAQALQARVIS--TYLSGACSCSQLSESPipSQKIFAALQTFNSLSPLIKFS 138
                     689***************************************************..777778888888877687999999*************** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     h+taNqaI +a++ge+ vHiiD+d++qGlQWp L++ LasRp++  s+RiTg+g+    s++ l +tg+rLa+fA++l +pfef+++v k  +  
  XP_013632002.1 139 HFTANQAIFQALDGEDSVHIIDLDVMQGLQWPGLFHILASRPRKLRSIRITGFGP----SSDVLASTGRRLADFAASLSLPFEFRPIVGKIGNVT 229
                     *******************************************************....9**************************988888888 PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse...sFlerflealeyysalfdsleaklpresee 281
                     ++++L  +pgEa++V+++   hrl+d +++  +     L++v++l+P+++++veqe++++++    Fl rf+eal+yysalfd+l  +l++es e
  XP_013632002.1 230 DPSRLGRRPGEAVVVHWMQ--HRLYDVTGNGID----ALEIVRRLRPNLITMVEQELSYDDGgggCFLGRFVEALHYYSALFDALGDGLGEESGE 318
                     ******************9..****98888888....*******************9885443449***************************** PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     r +vE+ +l+ ei+n+v  + +        +++W+e l+++GF+pv+l+ + a+qa lll + +++gy++ ee+g+l lgWkd +L+++SaW+
  XP_013632002.1 319 RFTVEQIVLATEIRNIVGGKRR-------GVMRWKEELSRVGFRPVSLRGNPATQAGLLLGMLPWNGYTLVEENGTLRLGWKDLSLLTASAWQ 404
                     *****************87665.......4899***********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.14319384IPR005202Transcription factor GRAS
PfamPF035142.6E-10746404IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MAAKRVHGDY PSSTDLSTVK RHKDLDFPED TTTALEDDGA AAINLLSLLL QCAEYVATDH  60
LREASILLSE ISETCSPFGS SPERVVAYFA QALQARVIST YLSGACSCSQ LSESPIPSQK  120
IFAALQTFNS LSPLIKFSHF TANQAIFQAL DGEDSVHIID LDVMQGLQWP GLFHILASRP  180
RKLRSIRITG FGPSSDVLAS TGRRLADFAA SLSLPFEFRP IVGKIGNVTD PSRLGRRPGE  240
AVVVHWMQHR LYDVTGNGID ALEIVRRLRP NLITMVEQEL SYDDGGGGCF LGRFVEALHY  300
YSALFDALGD GLGEESGERF TVEQIVLATE IRNIVGGKRR GVMRWKEELS RVGFRPVSLR  360
GNPATQAGLL LGMLPWNGYT LVEENGTLRL GWKDLSLLTA SAWQSQPSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-1375140325378Protein SCARECROW
5b3h_A1e-1375140324377Protein SCARECROW
5b3h_D1e-1375140324377Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, cotyledons, shoot apex, leaves and flowers.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013632002.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013632002.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLA0A0D3C0M60.0A0A0D3C0M6_BRAOL; Uncharacterized protein
TrEMBLA0A3P6C1060.0A0A3P6C106_BRAOL; Uncharacterized protein
STRINGBo4g143710.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM125122631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.10.0GRAS family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yoon EK, et al.
    Conservation and Diversification of the SHR-SCR-SCL23 Regulatory Network in the Development of the Functional Endodermis in Arabidopsis Shoots.
    Mol Plant, 2016. 9(8): p. 1197-1209
    [PMID:27353361]