PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013631638.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 368aa    MW: 40303.5 Da    PI: 6.1325
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013631638.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573118.63.3e-37100192298
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                      fqrlwseeDe+++LqG+idfka+tgksp++d+d+fye+ +ksisf++sk q+v+Kir+LK+K+ +kvk+   g e s++k+hd ++++l++ iW
  XP_013631638.1 100 SFQRLWSEEDEVSMLQGMIDFKADTGKSPYEDMDRFYEITSKSISFEASKIQFVDKIRSLKRKYMGKVKH---GAE-SLTKNHDIDCLKLANYIW 190
                     69*****************************************************************999...555.9***************** PP

          DUF573  97 gs 98 
                     gs
  XP_013631638.1 191 GS 192
                     95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.4E-28101191IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MTKKKPNPLE DPPKASSSDD NEVEALSGDD EEEQISNDSS SDDLMNPVAI PSAKNSKSEK  60
LNAVTKPKGG SLAVKKRPIE TTSVSAKRAK IAEEAKKPSS FQRLWSEEDE VSMLQGMIDF  120
KADTGKSPYE DMDRFYEITS KSISFEASKI QFVDKIRSLK RKYMGKVKHG AESLTKNHDI  180
DCLKLANYIW GSHGMALNSN VKKLGKEEEV VALESAAKSS GTPKKTKKKP VSVEANGDKV  240
EEDREALVSG DNGGEDRQVL AGGEKVAQDG EVLAGGEKNK EVLINGGGAS KSHGVRASDW  300
FEDSFLVGSI AGLGVSERFV KEKWSMVTVE TKKRMEEKWK LLQAKEMELV LHKTDFMREI  360
GSVIAEAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222229PKKTKKKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013631638.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0D3BYZ30.0A0A0D3BYZ3_BRAOL; Uncharacterized protein
STRINGBra032717.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.18e-66DNA-binding storekeeper protein-related transcriptional regulator