PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013630382.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 191aa    MW: 22396.3 Da    PI: 5.1649
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013630382.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF22.81.2e-071149341
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                    i + + r+ tf  R++ +  K +EL vLCd++ + +i+ 
  XP_013630382.1 11 ITDGRAREATFNLRKEELNQKLYELHVLCDVDTCAVIYN 49
                    6777899***************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.834150IPR002100Transcription factor, MADS-box
SMARTSM004325.1E-7160IPR002100Transcription factor, MADS-box
CDDcd002663.15E-19285No hitNo description
SuperFamilySSF554551.14E-18295IPR002100Transcription factor, MADS-box
PfamPF003194.3E-101150IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MGKKKMDLTY ITDGRAREAT FNLRKEELNQ KLYELHVLCD VDTCAVIYNQ YDPNPEVWPS  60
NSEVKSVLEK FEMLSEKEKT CRSVNHEEFL HQMIEKARTK RQKQNDQNKE KYMRELMFAF  120
LSGNMEDLSL NNDDRSELCS FIDQYLKELV QHKNQTLNNP NFEIGQSSSM ALDLNIAQTS  180
IAEAVRNLYI P
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013630382.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013630382.11e-142PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0D3AA301e-133A0A0D3AA30_BRAOL; Uncharacterized protein
STRINGBo1g088030.11e-134(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.12e-63AGAMOUS-like 46