PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013630167.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 600aa    MW: 65941.3 Da    PI: 5.2191
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013630167.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.44.5e-922455993374
            GRAS   3 elLlecAeavss.gdle.laqalLarlsel..aspdgd..pmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                      +Ll++Ae +++ gd++ laq +Larl+++  +s++ +  p+qR+a+++ eAL + +++       a pp   +++n + ++aa+++fse+sP+l
  XP_013630167.1 245 GQLLNAAELIATtGDHTiLAQGILARLNHHlsSSSYNNkaPFQRAASHISEALLSLIHD-------AAPP-LLTPENLILRIAAYRTFSETSPFL 331
                     6899****99986555559**********97533333245******************9.......4444.444589****************** PP

            GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                     +f ++taNq Ile   g er+HiiDfd+++G+QW +L+q+La ++++   l++T++++p s+  ++ el+ t+e+L++fA el++pfe ++l  +
  XP_013630167.1 332 QFVNFTANQSILEL--GFERIHIIDFDVGYGGQWSSLMQELARKRGS--CLKVTVFAPPPSTvsDEFELRFTEENLRSFAGELEIPFEMELLSLE 422
                     *************7..99************************98777..9********9988899**************************9888 PP

            GRAS 185 rledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                      l +  ++ L++++  +Ea+aVnl ++             + + +L+++k++sP+vvv++++ +d+n+++F + +++al+y+++l++sl+a+   
  XP_013630167.1 423 LLLNPAYWPLSLRSseKEAVAVNLPVSSVVSG--------YLPLILRFLKQISPNVVVCSDRGCDRNDAPFPNAVIHALQYHTTLLESLDAN--- 506
                     888889999988877799*****999655544........5677************************************************... PP

            GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                     +s+e+++vEr++++++i++++ +++++      +   Wr+ ++++GF+p++ls++a++qa++l+++ +++g++ve+++ slv++W++++Lv+vSa
  XP_013630167.1 507 QSQEDSSVERFWVRPSIEKLLVKRHRW----IDRSPPWRSLFTQCGFTPASLSQTAETQAECLMQRNPVRGFHVEKRQSSLVMCWQRKELVTVSA 597
                     8*************************9....88899*********************************************************** PP

            GRAS 373 Wr 374
                     W+
  XP_013630167.1 598 WK 599
                     *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.341218579IPR005202Transcription factor GRAS
PfamPF035141.6E-89245599IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MPLSFERFQG EGVFSVSSFY SDSHKIRFNQ DKTGIEEERE DLGYVFRGGL QEPTSVLDAL  60
RSPSPLASHS STTTNTTLSS PHGGGAVTAT ATTTAGDDKC SQIGLDDLDG VISPDQEQSI  120
LRLIMDPVSG FGVLDPGFGF GSGSAPVSDG SNPLLSCGFP FNEQTHQIPN QESLFSNPPS  180
SPPTKRFNSG SHQPVFPFSD PVPVQQYQFP VQYHPQQISS SSPAAALVPV PPLGIAGDDQ  240
SVIIGQLLNA AELIATTGDH TILAQGILAR LNHHLSSSSY NNKAPFQRAA SHISEALLSL  300
IHDAAPPLLT PENLILRIAA YRTFSETSPF LQFVNFTANQ SILELGFERI HIIDFDVGYG  360
GQWSSLMQEL ARKRGSCLKV TVFAPPPSTV SDEFELRFTE ENLRSFAGEL EIPFEMELLS  420
LELLLNPAYW PLSLRSSEKE AVAVNLPVSS VVSGYLPLIL RFLKQISPNV VVCSDRGCDR  480
NDAPFPNAVI HALQYHTTLL ESLDANQSQE DSSVERFWVR PSIEKLLVKR HRWIDRSPPW  540
RSLFTQCGFT PASLSQTAET QAECLMQRNP VRGFHVEKRQ SSLVMCWQRK ELVTVSAWKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-2728559939375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, cotyledons, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013630167.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893990.0AC189399.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB056I08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013630167.10.0PREDICTED: scarecrow-like protein 27
SwissprotQ7XJM80.0SCL27_ARATH; Scarecrow-like protein 27
TrEMBLA0A0D3B6T50.0A0A0D3B6T5_BRAOL; Uncharacterized protein
STRINGBo3g037600.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134171828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45160.10.0GRAS family protein
Publications ? help Back to Top
  1. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]
  2. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  3. Takanashi H, et al.
    miRNAs control HAM1 functions at the single-cell-layer level and are essential for normal embryogenesis in Arabidopsis.
    Plant Mol. Biol., 2018. 96(6): p. 627-640
    [PMID:29574557]