PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013629690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family VOZ
Protein Properties Length: 451aa    MW: 50240.4 Da    PI: 5.5099
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013629690.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4036.1e-1241853941217
             VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaael 95 
                     pppsaflgpkcalwdc+rpaqg +w+qdycssfha+la+neg+pg++pv+rp+gi+lkdgllfa+lsak+ gk+vgipecegaatakspwna+e 
  XP_013629690.1 185 PPPSAFLGPKCALWDCPRPAQGLDWFQDYCSSFHAALAFNEGPPGMNPVVRPGGIGLKDGLLFATLSAKAGGKDVGIPECEGAATAKSPWNAPE- 278
                     89*******************************************************************************************6. PP

             VOZ  96 fdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelkl. 189
                            +et+rewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm efgglkrsyymdpqp+++fewhlyeyeine+da+alyrlelkl 
  XP_013629690.1 279 -------SETLREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMSEFGGLKRSYYMDPQPLHHFEWHLYEYEINECDACALYRLELKLv 366
                     .......9*************************************************************************************73 PP

             VOZ 190 vdekksakgkvskdsladlqkklgrlta 217
                     vd+kk++kgk+s++s+adlqk++ rlta
  XP_013629690.1 367 VDGKKNSKGKLSTESVADLQKQMRRLTA 394
                     69************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MTGKRSKTTC RSVSHKLFKD KAKNRVDDLQ GMLLDLQFAR RESSALDVTL LEEQVNLMLR  60
EWKSELNEPS PASSLQHQGG GTLGSFSTDI CRLLQLCDEE DDATNKLAAP KPEPTDQNLE  120
PYGPLADHCK DPPLVVGNNL DGTAHLDYNL QQEFEPDFNG GFNDCPGYGV GGPLDISAFI  180
PTICPPPSAF LGPKCALWDC PRPAQGLDWF QDYCSSFHAA LAFNEGPPGM NPVVRPGGIG  240
LKDGLLFATL SAKAGGKDVG IPECEGAATA KSPWNAPESE TLREWLFFDK PRRAFESGNR  300
KQRSLPDYNG RGWHESRKQV MSEFGGLKRS YYMDPQPLHH FEWHLYEYEI NECDACALYR  360
LELKLVVDGK KNSKGKLSTE SVADLQKQMR RLTAEFPQEN NNNKRCIKGR TKVNTKVATG  420
NVQNTVEQTN EHGVGEEFNY LVGNLTDYYV N
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013629690.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1252561e-126AB125256.1 Arabidopsis thaliana AtVOZ1 mRNA for transcription factor AtVOZ1, complete cds.
GenBankAC0075081e-126AC007508.2 Genomic sequence for Arabidopsis thaliana BAC F1K23 from chromosome I, complete sequence.
GenBankAC0101551e-126AC010155.3 Genomic sequence for Arabidopsis thaliana BAC F3M18 from chromosome I, complete sequence.
GenBankAK2270141e-126AK227014.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL09-45-I22.
GenBankAK3170061e-126AK317006.2 Arabidopsis thaliana AT1G28520 mRNA, partial cds, clone: RAFL16-07-G16.
GenBankBT0202611e-126BT020261.1 Arabidopsis thaliana At1g28520 gene, complete cds.
GenBankCP0026841e-126CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629690.10.0PREDICTED: transcription factor VOZ1 isoform X3
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A3P6BFU00.0A0A3P6BFU0_BRAOL; Uncharacterized protein
STRINGBo3g143600.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]