PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013629168.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 487aa    MW: 53235.7 Da    PI: 7.9708
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013629168.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR42.31.4e-13346386240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCsee..CkCedCkNke 40 
                     ++k+C+CkkskCl++ CeCfa g++C+ e  C+C+dC+Nk 
  XP_013629168.1 346 SRKRCKCKKSKCLQLLCECFATGVYCTTEppCSCTDCFNKP 386
                     5799***********************9889********96 PP

2TCR36.78.6e-12437473239
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     +k gCnCkks+C+k YC+Cf+ g+ C+ +CkCe+C Nk
  XP_013629168.1 437 RKSGCNCKKSNCQK-YCQCFKGGVGCTVNCKCEGCGNK 473
                     689*********86.**********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508969.708840IPR006594LIS1 homology motif
SMARTSM006673.6E-4840IPR006594LIS1 homology motif
PfamPF085134.2E-71035IPR006594LIS1 homology motif
SMARTSM006670.5376108IPR006594LIS1 homology motif
PROSITE profilePS508968.24476108IPR006594LIS1 homology motif
PfamPF085135.3E-680103IPR006594LIS1 homology motif
SMARTSM011145.9E-12345388IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163429.656346475IPR005172CRC domain
PfamPF036387.1E-10348385IPR005172CRC domain
SMARTSM011143.2E-7436476IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-7439473IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MAQSNLEADK MLDAYIYDHL VKKKLHNTAK SFMTEGKVSP DLVAIDAPGG FLFEWWSVFW  60
EMYYARTKEK HDESAVEYGL NVYIYDYLVK KKLHYTANSF MTEVKVSPDH VVTDTPGGFL  120
FEWWSVFWDV YIAKTNEKHS ESAAEAQQGN TKEQMKQPVP MNTEPHMDAG TGHHGQIVQG  180