PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013628917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NAC
Protein Properties Length: 557aa    MW: 62401.8 Da    PI: 4.2513
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013628917.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.5e-5391361128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+kv +k+++l ++i+ +d+yk+ePwdLp+  k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgkd+e+ 
  XP_013628917.1   9 LAPGFRFHPTDEELVRYYLKRKVCNKPFKL-DAISVTDVYKSEPWDLPEksKLKSRDLEWYFFSMLDKKYNNGSKTNRATEKGYWKTTGKDREIR 102
                     579***************************.99**************95246777777************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  XP_013628917.1 103 N-GSRAVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                     9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-627159IPR003441NAC domain
PROSITE profilePS5100558.5049159IPR003441NAC domain
PfamPF023655.1E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MGRGSATSLA PGFRFHPTDE ELVRYYLKRK VCNKPFKLDA ISVTDVYKSE PWDLPEKSKL  60
KSRDLEWYFF SMLDKKYNNG SKTNRATEKG YWKTTGKDRE IRNGSRAVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLTDEE LKRTGAPQDA YVLCRIFQKS GTGPKNGEQY GAPYLEEEWE  180
EDKMTFVPEQ EALSEGLGVD YDVYLDIDEF DEKPENLVVY DAIPVEPNYY HGESSNNVES  240
GNYSDSGNYI QQIDSGGCFE QPIETFEEDQ KPIIRDGSIQ PCSLFPNEQN DENVVNLQTS  300
NDNVFAAENC YSDIPIDTNY MPDESFIDPS NNLPLSDGLY LEGNDLGNAL PDDFDFEDYL  360
EFFDDEDAQN LTLDVSQLLG SEDALPDQEG SDQMQPSSED LEKNVAEGKE AVEKDESGEG  420
SSSKQDADVT DFDSASKYPF LKKASQMCGA TSSFASQFQT KDGRLHAGQS SGSVHVTAGI  480
IRISNMNLAA DMGWSYDKNS NLNVVLSFGL VQRDDGMSSS VNKTGGVPAR RAMLIFICLW  540
ALLLSVSFKI GTMVSAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-45816516171NO APICAL MERISTEM PROTEIN
1ut4_B1e-45816516171NO APICAL MERISTEM PROTEIN
1ut7_A1e-45816516171NO APICAL MERISTEM PROTEIN
1ut7_B1e-45816516171NO APICAL MERISTEM PROTEIN
4dul_A1e-45816516171NAC domain-containing protein 19
4dul_B1e-45816516171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in root meristem (Ref.1). Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013628917.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013628917.10.0PREDICTED: NAC domain-containing protein 78-like isoform X1
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A0D3AZP50.0A0A0D3AZP5_BRAOL; Uncharacterized protein
STRINGBo3g002800.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]