PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013628510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 984aa    MW: 110254 Da    PI: 8.2004
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013628510.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B361.31.6e-19122212498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      ++ +   +++rl+lp +f +e+g++k++  ++ l   +g +W  +l  + ++gr++ ++GWk+FvkangLk g++ +++l++ +++++v++++ 
  XP_013628510.1 122 FTLAPVDVRHCRLRLPMQFSRENGINKPG--KIYLLGNDGSKWLANL-LQESRGRMTVGDGWKSFVKANGLKIGESYTLELNW-EDTTPVLSLCP 212
                     5556667899**************99776..8***************.78999999*************************99.88889999986 PP

2B3642.2e-20278368195
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++d+l++grl+lp +f++e++++   + ++tl  ++g +W   l    ++gr+ l+kGWk+F+kangLk+gD+++++ ++ ++ ++v++
  XP_013628510.1 278 FLTLTITPDSLRHGRLRLPLEFMTENSMNR--PGDITLLGKDGAKWLASLL-LERRGRMCLGKGWKDFAKANGLKTGDSITLESIW-EDSTPVLR 368
                     778899********************9885..558***************6.55556778***********************999.55556665 PP

3B365.48.4e-215896731098
                     HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                       +++rl+lp +f++e+g++k++  ++ l  ++g +W  +l    ++gr++l++GWk+FvkangLk+g+++++kl++ +++++v++++ 
  XP_013628510.1 589 DVRNCRLRLPMQFTRENGINKPG--KIYLLGKDGSKWLANL-LLESRGRMTLGDGWKSFVKANGLKTGESFTLKLNW-EDATPVLSLCP 673
                     5689**************99776..8***************.68888899*************************99.89999999986 PP

4B367.81.5e-21741832398
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     + ++++d+lk+grl+lp +f+++++++k++  ++tl  ++g +W v l    k+gr+ l+kGWk+F+kangLk+gD+++++ ++ +++++v++++
  XP_013628510.1 741 TLTITPDSLKHGRLRLPLEFMTDNSMNKPG--EITLLGKDGVKWLVSLL-LEKRGRMSLGKGWKDFAKANGLKTGDSITLESIW-ENATPVLSLL 831
                     56789*******************999766..8***************5.66667889***********************999.8888999888 PP

                     - CS
              B3  98 r 98 
                     r
  XP_013628510.1 832 R 832
                     7 PP

5B348.51.6e-15888973796
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     ++   + + l lp +f++++g+ +++  ++tl  +sg +W  +l    k+g++ l++GWk+F++ang+ +g+++v++l+ ++++  v+k+
  XP_013628510.1 888 TPEGVRDCKLQLPSQFMRTNGIMNPG--KITLLGRSGMKWFAYL--LSKDGTIALENGWKGFCEANGVMVGESFVLELIPTQDADQVFKF 973
                     566678899***********877544..8***************..9999***************************9976666666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.6E-21117214IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-20117213IPR015300DNA-binding pseudobarrel domain
CDDcd100171.47E-16118212No hitNo description
SMARTSM010199.8E-29119214IPR003340B3 DNA binding domain
PROSITE profilePS5086314.649119214IPR003340B3 DNA binding domain
PfamPF023622.5E-19119212IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.9E-21268369IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.42E-22274369IPR015300DNA-binding pseudobarrel domain
CDDcd100179.41E-19278370No hitNo description
SMARTSM010191.0E-29278373IPR003340B3 DNA binding domain
PfamPF023629.1E-20278369IPR003340B3 DNA binding domain
PROSITE profilePS5086315.256278373IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.2E-23575680IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-22577679IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.4E-27580675IPR003340B3 DNA binding domain
PROSITE profilePS5086314.819580675IPR003340B3 DNA binding domain
CDDcd100172.61E-17584673No hitNo description
PfamPF023623.5E-20586673IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-20730837IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.47E-23735831IPR015300DNA-binding pseudobarrel domain
CDDcd100172.18E-20738832No hitNo description
SMARTSM010195.2E-32739834IPR003340B3 DNA binding domain
PROSITE profilePS5086315.763739834IPR003340B3 DNA binding domain
PfamPF023625.1E-21740832IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.8E-17877965IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.2E-17878964IPR015300DNA-binding pseudobarrel domain
CDDcd100172.28E-13881974No hitNo description
SMARTSM010191.2E-17882977IPR003340B3 DNA binding domain
PROSITE profilePS5086312.915882977IPR003340B3 DNA binding domain
PfamPF023622.5E-14887975IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 984 aa     Download sequence    Send to blast
MMFQVSDVGH RDVETPSSNN GQDSIGSMNK KHPYARPEAG FSSNHGDNQD NDELPRKRNY  60
PETEKGSSSR HSCIVADATT ASSLHTYTPV FLTQDFTSLG GLKGKCSPKR IISSMGTRFV  120
TFTLAPVDVR HCRLRLPMQF SRENGINKPG KIYLLGNDGS KWLANLLQES RGRMTVGDGW  180
KSFVKANGLK IGESYTLELN WEDTTPVLSL CPTDHHSVGI RADGECSEAS ENESLPIKPS  240
NGTEVIKYDN RKDESSSWER EKNHLRSRDS SSASQNRFLT LTITPDSLRH GRLRLPLEFM  300
TENSMNRPGD ITLLGKDGAK WLASLLLERR GRMCLGKGWK DFAKANGLKT GDSITLESIW  360
EDSTPVLRLL HIESTDDRRQ QGECSKAREK ESAFTEPSSG NKTRKLESNR EESRIYPLTR  420
LDSSLVNQNR FETSTVSPEI VRYGAHDYQI GEIVVFRDER DMMFQVSDLG PRFSEIQNVL  480
SPSSNSDQEN IGSISIVRKE TGFSLYDGDD QYNIELPRKK KAKKNNPGTE ADSSPERSCF  540
VAHVTASNLH TDAPHLPQDF TSSNSRTQIV SSYLSSEKQL ATFTLAPVDV RNCRLRLPMQ  600
FTRENGINKP GKIYLLGKDG SKWLANLLLE SRGRMTLGDG WKSFVKANGL KTGESFTLKL  660
NWEDATPVLS LCPPECSIDS REGGECSETI EKEPLPIVLS CEKEISKDDE NRKKESSSWE  720
RETNLLIWRD STVLSQNRCL TLTITPDSLK HGRLRLPLEF MTDNSMNKPG EITLLGKDGV  780
KWLVSLLLEK RGRMSLGKGW KDFAKANGLK TGDSITLESI WENATPVLSL LRVESSNDIE  840
VSKQSGSSSG NKTRKAENRR EGSSSWELEK RRYSSSAFQN RIVILTLTPE GVRDCKLQLP  900
SQFMRTNGIM NPGKITLLGR SGMKWFAYLL SKDGTIALEN GWKGFCEANG VMVGESFVLE  960
LIPTQDADQV FKFYSNYGYH IHKC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013628510.10.0PREDICTED: B3 domain-containing protein REM-like 1
SwissprotQ8S8E80.0REML1_ARATH; B3 domain-containing protein REM-like 1
TrEMBLA0A0D3B7J30.0A0A0D3B7J3_BRAOL; Uncharacterized protein
STRINGBra000563.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150791619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24690.10.0B3 family protein