PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013627046.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 583aa    MW: 64549.2 Da    PI: 8.3549
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013627046.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.77.1e-16301339240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+C+CkkskClk+YCeCfaag++C e+C+C dC Nk 
  XP_013627046.1 301 ACKRCHCKKSKCLKLYCECFAAGVYCLESCSCVDCYNKP 339
                     589**********************************96 PP

2TCR49.86.9e-16387426140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnC+ks+C+kkYCeC+++g+ Cs +C+Ce+CkN  
  XP_013627046.1 387 RHKRGCNCRKSNCVKKYCECYQSGVGCSINCRCEGCKNAF 426
                     589***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.3E-16300341IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.499301427IPR005172CRC domain
PfamPF036388.8E-12303338IPR005172CRC domain
SMARTSM011143.3E-16387428IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.0E-11389425IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
METPQKTIIQ NGTPVSKLKN SPVFNYINNL SPINSVRLIP IAQTFGSLSP SVYTPPHKGS  60
RFKSHTYFSD PSKELVEEAL LETIPPEILK NDCISTPPRR AAANDGSCGD GETDLQRMCD  120
GNVKRKSDTP DWETQFPDTP EMLIYDTLND SEADRCFLPA SSDSKRRSCG GTKPRLEPVS  180
NSKELADSLH RGVRRRLLDF EMPYKQTSEK SSSSCVVPPS TVLHLNAFAM SFKDINVGNE  240
YSLSGNIKAG LQKFENETGE AAGQSVVEEV QKSSLALVEM NQSSPKKKRL KSEQAGEGES  300
ACKRCHCKKS KCLKLYCECF AAGVYCLESC SCVDCYNKPI HEDTVLATRK QIESRNPIAF  360
APKVIRNTDS SIMEAGVDAS KTPASVRHKR GCNCRKSNCV KKYCECYQSG VGCSINCRCE  420
GCKNAFGKKD VSSFVGMDIK QDDVSETWKT QQNNELVRYV PLPPSTPMLL RQPLAQLPIS  480
SNNMLLPQQS QHLHGASGSS LYESQSFRKQ GTSLLSHSRT EKIIEDIENL IQSPITNINA  540
VSPNSKRVSL PHLDSPELTP RRRNGERKLL LSIPTFPSFA PHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-1630542414120Protein lin-54 homolog
5fd3_B8e-1630542414120Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers and at significant levels in leaves. Detected with highest levels in developing ovules and microspores, and in petals. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013627046.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893271e-166AC189327.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB037A01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627046.10.0PREDICTED: protein tesmin/TSO1-like CXC 3 isoform X1
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A0D3BCT60.0A0A0D3BCT6_BRAOL; Uncharacterized protein
STRINGBo3g081380.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]