PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013626556.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 515aa    MW: 56370.4 Da    PI: 4.9689
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013626556.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.92.6e-15381419240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+C+Ck+s+Clk+YC+Cfaag +C e C+C++C+N+ 
  XP_013626556.1 381 SCKRCRCKRSRCLKLYCDCFAAGLYCVEPCSCQNCFNRP 419
                     589**********************************85 PP

2TCR44.14.2e-14467504239
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     +++gCnCkks C kkYCeC+  g+ Cs +C+C +CkN 
  XP_013626556.1 467 HMRGCNCKKSGCSKKYCECYLVGVGCSASCRCIGCKNI 504
                     889**********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.7E-16380421IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163433.891381506IPR005172CRC domain
PfamPF036386.5E-11383418IPR005172CRC domain
SMARTSM011145.6E-13466507IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-11469503IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MDTPDKNRIS AVSYCNFEDS PVFQYINGLS PIEPVKAGHA FHSLALASPS SLFRSPQIDC  60
VKRHHSVDLS SPVVSLGRED VLVELKCGGP DEEMANVSET KAFKEQVKLA IEMASSLSTQ  120
MGSSDEVVVP MDAENEVMKQ SGELCTQLLN ELDADSDMVI QTEEMEAENG SGEQEIPNAK  180
DSRICSFTSV PQQFSNHSGN VVQPCSSVHV AAGALDTTLS SSSNVAAFDS TAKAEDDDEE  240
ANLQLSSKQR SVRRRCLTFD LGGSYKRVPL RDSTNDFPFD FTSINEAPSP QKCIDSSKQE  300
TDEILPVPRT IGLHLNALVN PSVSRNGNKF TAKDGCVLSH AAEEFTTPVY TIRDLVACDN  360
QIMEEASERS MEGEWVEELG SCKRCRCKRS RCLKLYCDCF AAGLYCVEPC SCQNCFNRPI  420
HEDIVIKSRR NVEARNPLAF APKVVLTSAS ATYIGEESNK TPASARHMRG CNCKKSGCSK  480
KYCECYLVGV GCSASCRCIG CKNILCQTNE QFHLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1738350412121Protein lin-54 homolog
5fd3_B1e-1738350412121Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1383388RCRCKR
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013626556.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893291e-180AC189329.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB037C07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626556.10.0PREDICTED: protein tesmin/TSO1-like CXC 4
SwissprotQ84JZ80.0TCX4_ARATH; Protein tesmin/TSO1-like CXC 4
TrEMBLA0A0D3B9Q10.0A0A0D3B9Q1_BRAOL; Uncharacterized protein
STRINGBo3g058650.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148401620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.11e-175Tesmin/TSO1-like CXC domain-containing protein