PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013626503.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TCP
Protein Properties Length: 244aa    MW: 27292.2 Da    PI: 6.9123
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013626503.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP89.95.4e-2838108373
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                     g+kdrhsk++T +g+RdRR+Rlsa++a++++dLq++LG+ ++sk i+WLl++a+  +  l+ +++++  + 
  XP_013626503.1  38 GGKDRHSKVCTVRGLRDRRIRLSATTAIQLYDLQERLGLSQPSKVIDWLLEAAQNDVAMLPPLQFPPGFHP 108
                     68*************************************************************66666333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036347.2E-2739146IPR005333Transcription factor, TCP
PROSITE profilePS5136926.6533997IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MRTNSMGIKQ EGDNHYQATS LSSLRQNPRI VRASRIFGGK DRHSKVCTVR GLRDRRIRLS  60
ATTAIQLYDL QERLGLSQPS KVIDWLLEAA QNDVAMLPPL QFPPGFHPNL TAAAGESFPG  120
NFESFDLGSC SSRTDTTLQR EGLNLESHGF DIDHHFFSNS NHRDKLYFPS SSSCHYNLEQ  180
LQQSLLDQSG NVTVALSNNN HLNPSAVETM SSLFPRYPLF HEGGDQLQLF SSNSNSSKQT  240
DHVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A8e-174498155Putative transcription factor PCF6
5zkt_B8e-174498155Putative transcription factor PCF6
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:25378179}.
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, roots, stems, buds, flowers and siliques. {ECO:0000269|PubMed:17307931}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00497DAPTransfer from AT5G08070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013626503.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410040.0AC241004.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB026J02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626503.10.0PREDICTED: transcription factor TCP17
RefseqXP_013626504.10.0PREDICTED: transcription factor TCP17
RefseqXP_013626505.10.0PREDICTED: transcription factor TCP17
SwissprotQ9LEZ98e-92TCP17_ARATH; Transcription factor TCP17
TrEMBLA0A0D3B0820.0A0A0D3B082_BRAOL; Uncharacterized protein
TrEMBLA0A3P6A8B20.0A0A3P6A8B2_BRAOL; Uncharacterized protein
STRINGBo3g004670.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35762763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08070.15e-83TCP domain protein 17
Publications ? help Back to Top
  1. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]