PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013625082.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 490aa    MW: 54046.6 Da    PI: 8.5284
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013625082.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.4e-33169226260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  +++++ei+Y+g+Hnh+k
  XP_013625082.1 169 EDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERSL-EGQITEIVYKGSHNHPK 226
                     7****************************************.***************85 PP

2WRKY105.52.8e-33333391159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d ++v++tYeg+Hnh+
  XP_013625082.1 333 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTIGCPVRKHVERASQDLRAVITTYEGKHNHD 391
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-27163227IPR003657WRKY domain
SMARTSM007741.0E-33168226IPR003657WRKY domain
SuperFamilySSF1182902.75E-24168227IPR003657WRKY domain
PROSITE profilePS5081122.905169227IPR003657WRKY domain
PfamPF031067.2E-25169225IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.5E-37318393IPR003657WRKY domain
SuperFamilySSF1182904.45E-29325393IPR003657WRKY domain
PROSITE profilePS5081138.124328393IPR003657WRKY domain
SMARTSM007744.6E-38333392IPR003657WRKY domain
PfamPF031061.5E-25334391IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MAASSLLPID NNTTRQNMSG SANWSRRSSA SLEDLEIPNF RSFAPSSVSI SPSTCFSPSV  60
FLDSPAFVAS SANVLASPTT GALITNERNQ KNVTKEEKNN NNNINFFDFS FQTQSSALSA  120
PTTTATNSSI FQSQEQERKN QSDQWSQTLN NSNNQQAGSY NGREQRKGED GYNWRKYGQK  180
QVKGSENPRS YYKCTFPSCP TKKKVERSLE GQITEIVYKG SHNHPKPQST RRSSSSSSST  240
FHSAVFNASL DNSFSHSDSL AIQQDDNTTS GSVGDDEFER GSSVVSREEE CGSEPEAKKW  300
KGESETNGGN GNGSKTVREP RIVVQTTSDI DILDDGYRWR KYGQKVVKGN PNPRSYYKCT  360
TIGCPVRKHV ERASQDLRAV ITTYEGKHNH DVPAARGSGY ATNRQVQDPS SAPIRPAAIA  420
GHTNYTTSRP PYTLQMLQNN NNTNAGRFGY AMNSHNNIQT QQNEFVGGGF SRAKEEPNDE  480
SSSFFDSFLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-38169394878Probable WRKY transcription factor 4
2lex_A3e-38169394878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bol.74540.0leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4765200.0KC476520.1 Brassica oleracea var. italica WRKY protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625082.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P50.0WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A078FNI50.0A0A078FNI5_BRANA; BnaC03g21360D protein
TrEMBLA0A0D3B5M40.0A0A0D3B5M4_BRAOL; Uncharacterized protein
TrEMBLM9UVJ70.0M9UVJ7_BRAOT; WRKY protein
STRINGBra000064.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.10.0WRKY DNA-binding protein 33