PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013624242.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 349aa    MW: 39925.7 Da    PI: 9.0647
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013624242.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.54.9e-2023601350
                    HHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF 13 fskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    ++kR++ ++KKA+ELS+LC++ev+vi+++s+g+l++++
  XP_013624242.1 23 LTKRQENVFKKANELSILCGVEVCVIYYGSNGELKTWP 60
                    79***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.4E-41362IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-172292IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.2642363IPR002100Transcription factor, MADS-box
CDDcd002662.51E-162384No hitNo description
PfamPF003195.9E-142459IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-52540IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-54061IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MASYSSSSSS LFKKPSSSEA KRLTKRQENV FKKANELSIL CGVEVCVIYY GSNGELKTWP  60
EDREKVKDMA RRYSELSEAK REVKQYDLDL FLESIKKDND SKNKKKKKKR AKLGSSYKYP  120
DWHPRFDKYS VEQLEVLIQS LERSQTMMQH RLRAVVESQR QRNMHYTNMA GQEQIMVPER  180
SNQASMNLFN HGNSTLPQSQ ASISASNQAY SLAPLPNSLT IHQDPNMEMY SRLLASQGAG  240
MNEVFNTSML PYNGFNTNCL NGFSNQFYQN CFEVEDPYGV QGAGINNNMK VEDYSGLLWT  300
QGTGMNGLQN GYNSNNNNTN GYPHQLVQTP PVYQYMDRST QSVRPLYEI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103109KKKKKKR
2105112KKKKRAKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013624242.10.0PREDICTED: agamous-like MADS-box protein AGL93
SwissprotQ9LSB25e-90AG103_ARATH; Agamous-like MADS-box protein AGL103
TrEMBLA0A0D3BC090.0A0A0D3BC09_BRAOL; Uncharacterized protein
STRINGBra022341.1-P1e-130(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.12e-75AGAMOUS-like 103