PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013623871.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 274aa    MW: 31459 Da    PI: 8.2386
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013623871.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.23.7e-171051243
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    ri n+  r +t+ kR++ ++KKA+E S+LC+++ ++i++++t
  XP_013623871.1 10 RIMNEKTRITTYRKRKECLFKKANEFSTLCGVNTCLIVYGPT 51
                    899*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.5E-16160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.063151IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.02E-19296IPR002100Transcription factor, MADS-box
CDDcd002661.08E-25282No hitNo description
PRINTSPR004048.3E-7323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-161051IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRKMVKMAR IMNEKTRITT YRKRKECLFK KANEFSTLCG VNTCLIVYGP TRAGDERIDH  60
PELWPKDERK VREIITKYRD TASSSCIKTY SVQECLEKGK IKLEKEKYCP WDNKLEKCSL  120
NELYATFVTV CNKIQEAANR KQTFPDASWS THRDQLGLIG YNQPCLEQHQ LFPMSSMEQN  180
GFAFLPFLNQ MTSTSNTGEV ASFSNVTEPE MTQAMFYGSC SDGQYAPMVQ KTDYMEPVQW  240
GLGNSMFSNV KPFADYPMRF GQVNDLESSG KTPM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895420.0AC189542.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH004B20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013623871.10.0PREDICTED: uncharacterized protein LOC106329774
TrEMBLA0A078HH720.0A0A078HH72_BRANA; BnaA03g11270D protein
TrEMBLA0A0D3B3B10.0A0A0D3B3B1_BRAOL; Uncharacterized protein
STRINGBra028965.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59481947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-134M-type_MADS family protein