PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013623376.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 407aa    MW: 46198 Da    PI: 10.2922
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013623376.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3573.6e-18221011198
                     HHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  11 lksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     ++s+ l +p +f+ +h +gk +e++t++l++ +s r+W vk+  ++++    lt+GWkeF+ka++L++gD+v+F+++g++ f  +v++f 
  XP_013623376.1  22 FQSH-LNIPVTFFCKHiEGK-HEGRTVKLRSdSSDRTWIVKI--EGHR----LTQGWKEFAKAHDLRVGDVVIFRHEGDMLF--HVTAFG 101
                     4555.99****977885555.5778*****96777*******..6666....***********************9999988..888776 PP

2B360.33.2e-19142235298
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     f++ +++++l++g + +p +fa+++g++k + + + l++++g++We kl+ + +sg++++ ++W++F+ a +Lk gD++ Fkl + +++++v+++
  XP_013623376.1 142 FSQYVTASNLSRGAVGVPLDFARRNGLNKGK-RVIALRNQEGKTWESKLK-STRSGQVFICRNWRSFCTASKLKIGDSFPFKLLE-NTETPVFQL 233
                     6788999********************9866.69***************5.55556788899********************988.666699999 PP

                     E- CS
              B3  97 fr 98 
                     ++
  XP_013623376.1 234 CS 235
                     97 PP

3B353.54.3e-17263360199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE..EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr..yvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                     f+k++t++++l+ g   +p +f+++++++k++  +++l d++  +W++kl+ + +sg+  ++ ++ Wk+F+ an++ +g++++++l++ +++ l+
  XP_013623376.1 263 FVKITTTASSLEIGKQNIPVHFTRANKLNKPG--KIVLVDKDKVEWSMKLNQDSRSGTmyIMGGTAWKSFCAANEVVVGESLTLELIR-RGGILL 354
                     89***************************776..7***************7755555554444588*********************9.566588 PP

                     EEEE-S CS
              B3  94 vkvfrk 99 
                     +k+++k
  XP_013623376.1 355 LKFCSK 360
                     888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.9E-248104IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-229109IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.23911103IPR003340B3 DNA binding domain
CDDcd100177.63E-1812100No hitNo description
SMARTSM010191.5E-2214103IPR003340B3 DNA binding domain
PfamPF023622.9E-122498IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-19134234IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-19137234IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.1E-23141237IPR003340B3 DNA binding domain
PROSITE profilePS5086313.634141237IPR003340B3 DNA binding domain
CDDcd100177.36E-15141235No hitNo description
PfamPF023629.7E-19142235IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.6E-17257360IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-16258364IPR015300DNA-binding pseudobarrel domain
CDDcd100171.08E-17261359No hitNo description
SMARTSM010191.5E-24263361IPR003340B3 DNA binding domain
PROSITE profilePS5086313.507263361IPR003340B3 DNA binding domain
PfamPF023624.2E-16263360IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MEKASLLTPA NPHFFQPLLT GFQSHLNIPV TFFCKHIEGK HEGRTVKLRS DSSDRTWIVK  60
IEGHRLTQGW KEFAKAHDLR VGDVVIFRHE GDMLFHVTAF GTSFCEIQYA PSSIHVKVKE  120
ESEEIGESSR REKESSSKPT CFSQYVTASN LSRGAVGVPL DFARRNGLNK GKRVIALRNQ  180
EGKTWESKLK STRSGQVFIC RNWRSFCTAS KLKIGDSFPF KLLENTETPV FQLCSLSKVK  240
PKKETLSETE EDNVVDKTET PRFVKITTTA SSLEIGKQNI PVHFTRANKL NKPGKIVLVD  300
KDKVEWSMKL NQDSRSGTMY IMGGTAWKSF CAANEVVVGE SLTLELIRRG GILLLKFCSK  360
MEQPPFKTKA RKHKRARVQR LTRESRSKDD VSNQEAKVKT ECLSYYN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892171e-173AC189217.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010F06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013623376.10.0PREDICTED: B3 domain-containing protein REM8-like
SwissprotQ8H2D11e-150REM8_ARATH; B3 domain-containing protein REM8
TrEMBLA0A0D3A2T30.0A0A0D3A2T3_BRAOL; Uncharacterized protein
STRINGBra011289.1-P1e-165(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.11e-140B3 family protein