PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013623370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 179aa    MW: 20230.8 Da    PI: 5.0473
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013623370.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.73e-181157349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    ++++  +qvtfskRr g++KKA EL +LC+aev +++fs+ +k y y
  XP_013623370.1 11 VQDTNTKQVTFSKRRIGLFKKAGELATLCNAEVGIMVFSPGNKPYPY 57
                    6788899*********************************9998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.01E-25173IPR002100Transcription factor, MADS-box
SMARTSM004324.3E-31160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.231161IPR002100Transcription factor, MADS-box
CDDcd002655.54E-31276No hitNo description
PRINTSPR004041.5E-18323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-201157IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MGRRKIKMEK VQDTNTKQVT FSKRRIGLFK KAGELATLCN AEVGIMVFSP GNKPYPYGSP  60
SFELVAERYN NESEDSDSCE TSGNGRGNRA RQEKRICKRL NSIMEQVEAE KKRGEDFEHQ  120
LETAGGEEKF DKPIEELSLE ELEEYEGKMM DMLGSIQGNI SGMEVSSTLL IMSKDTQNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17178178Myocyte-specific enhancer factor 2B
1tqe_Q2e-17178178Myocyte-specific enhancer factor 2B
1tqe_R2e-17178178Myocyte-specific enhancer factor 2B
1tqe_S2e-17178178Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892330.0AC189233.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB013O20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013623370.11e-129PREDICTED: agamous-like MADS-box protein AGL61
SwissprotO647037e-60AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBLA0A0D3BA091e-129A0A0D3BA09_BRAOL; Uncharacterized protein
STRINGBra001209.1-P1e-116(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G66656.11e-76AGAMOUS-like 91