PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013622499.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 640aa    MW: 70894.1 Da    PI: 6.0065
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013622499.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR512.8e-16352390240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  XP_013622499.1 352 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNKP 390
                     689**********************************96 PP

2TCR52.21.2e-16438476139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  XP_013622499.1 438 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 476
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19351392IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.394352478IPR005172CRC domain
PfamPF036387.0E-12354389IPR005172CRC domain
SMARTSM011144.2E-17438479IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.0E-12440476IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MDNENSQKEP ASKIETPTPK SKFEDSPVFN FINNLSPFEP VKSFSSAQTF SSLNFTSPPP  60
VFASPHPNFH RESRFFRCQH SVDRSKALGD GSVSKEDREV DLNKDATLED EEEEDTETSC  120
ELPQILSSDG QSPPHHGEDI VTQTLLPPSD PPLGEDNNGS SMNRLQKIPD SQEEENGTPD  180
SRRLMADAAA ELLVFRSPND SEAFTCLVDK ISSSERRFFA GVKHHHIIPA NGSSNDNEPL  240
AVVPNQLVSN VHRGSMRRRC LDFEVPGKRK KDDDQQTVCD NNKPESSSSK CVVPGSITPV  300
HSQDTVPETL DQAESQPGEE APKALVFEEL IPDSLQKKKQ VLEGGEGEGE SSCKRCNCKK  360
SKCLKLYCEC FAAGVYCIEP CSCVDCFNKP IHEDTVLATR KQIESRNPLA FAPKVIRNSD  420
SSIMDTSDDA SKTPASARHK RGCNCKKSNC LKKYCECYQS GVGCSINCRC EGCKNAFGRK  480
DAYLHTIMES KQEDDHETYE KRTEKIQQNS KEVEQNPQPS TPLPPYRNLV VHQPFLSRNK  540
LPPTQFFLGA GSSSFRKPDC DVTQSMNEKK SLETVTEDKT EIMPDILNTS PIKANSPNSK  600
RVSPAHIGPS EPGSILGKRS NGRKLILRSI PAFPSLNPNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-1735647514120Protein lin-54 homolog
5fd3_B8e-1735647514120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256270RRRCLDFEVPGKRKK
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the first stage of pollen development in uninucleate microspores and bicellular pollen but not in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers with highest levels in developing ovules and microspores. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013622499.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013622499.10.0PREDICTED: CRC domain-containing protein TSO1-like isoform X3
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A0D3BCT70.0A0A0D3BCT7_BRAOL; Uncharacterized protein
STRINGBo3g081390.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]