PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013621571.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TCP
Protein Properties Length: 225aa    MW: 23567.4 Da    PI: 9.8483
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013621571.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP125.46e-3921102283
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                     a+kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as+++a+ s+ss+ 
  XP_013621571.1  21 AVKKPPTKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTASLSVSSSP 102
                     79*******************************************************************8885555555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.9E-3327106IPR005333Transcription factor, TCP
PROSITE profilePS5136928.2872781IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MENNDGAMTN GVIINKGPLN AVKKPPTKDR HSKVDGRGRR IRMPIICAAR VFQLTRELGH  60
KSDGQTIEWL LRQAEPSIIA ATGTGTTPAS FSTASLSVSS SPFALGKRVV RAEEEGESGG  120
PGGGGELTVG HTMSGGGGGF WAVPARQDFG QVWSFAAGAT PEMLFTQQQQ AATLFVRQQQ  180
QAVAAMGEAS AARVGNYLPG HHLNLLASLS GGSPGSGRRE EDDSR
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves, roots, and stems. {ECO:0000269|PubMed:19286557}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the regulation of the circadian clock. Acts as a repressor of CCA1 by binding to its promoter. No binding to the LHY promoter. {ECO:0000269|PubMed:19286557}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013621571.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013621571.11e-164PREDICTED: transcription factor TCP21-like
RefseqXP_013675750.11e-164transcription factor TCP21 isoform X1
SwissprotQ9FTA21e-108TCP21_ARATH; Transcription factor TCP21
TrEMBLA0A078I1M71e-163A0A078I1M7_BRANA; BnaC02g01170D protein
TrEMBLA0A0D3AI711e-163A0A0D3AI71_BRAOL; Uncharacterized protein
TrEMBLA0A3P6CVS11e-163A0A3P6CVS1_BRAOL; Uncharacterized protein
STRINGBo2g009040.11e-163(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17822685
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.12e-75TCP family protein
Publications ? help Back to Top
  1. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  2. Ng DW,Chen HH,Chen ZJ
    Heterologous protein-DNA interactions lead to biased allelic expression of circadian clock genes in interspecific hybrids.
    Sci Rep, 2017. 7: p. 45087
    [PMID:28345627]
  3. Lee CM, et al.
    Decoys Untangle Complicated Redundancy and Reveal Targets of Circadian Clock F-Box Proteins.
    Plant Physiol., 2018. 177(3): p. 1170-1186
    [PMID:29794020]