PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013621067.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 497aa    MW: 55751.3 Da    PI: 6.786
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013621067.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4554.7e-1391274972374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +  L++cA+a+s++dl +a++++++l+ ++s +g+p++Rl ay++e+L a+l++s+s++yk+l+  +++   s++ l+++++++ev+P++kf+++
  XP_013621067.1 127 RADLVSCAKAMSENDLMMARSMMEKLRLMVSVSGEPIERLGAYLLEGLVAQLSSSGSSIYKSLNQCPEP--ASTDLLSYMHILYEVCPYFKFGYM 219
                     678************************************************************766665..499********************* PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      aN aI ea+++e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg+++ +s   +   l+ +g+rLak+A++++vpfefn  v+ +++++
  XP_013621067.1 220 SANGAIAEAMKEENRVHIIDFQIGQGSQWVTLIQAFAARPGGPPRIRITGIDDTTSAyaRGGGLSIVGNRLAKLAKQFNVPFEFNS-VSVSVSEV 313
                     *****************************************************998899999************************.7999**** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++++L v+pgEalaVn+++ lh+++desvs+e++rd++L++vkslsPkvv++veqe+++n++ F+ rf e+++yy a+f+s++++lpr++++ri+
  XP_013621067.1 314 KPKNLGVRPGEALAVNFAFVLHHMPDESVSTENHRDRLLRMVKSLSPKVVTLVEQESNTNTAAFFPRFKETMDYYDAMFESIDVTLPRNHKQRIN 408
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     vE+++l+r++vn++acega+r+erhe l+kWr+r+++aGF+p+pls  +++++++llr+++++ yr+ee++g+l+lgW++r Lv+ +aW+
  XP_013621067.1 409 VEQHCLARDVVNIIACEGADRVERHELLGKWRSRFGMAGFTPYPLSPLVNSTIRSLLRNYSDK-YRLEERDGALYLGWMKRDLVASCAWK 497
                     *************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.85100478IPR005202Transcription factor GRAS
PfamPF035141.6E-136127497IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MYKHPRQEIE AYSLPANSVG KRRYVPVHNS RKRYCTPESS SPDSPAHDVI SNATVLVSHN  60
NSAYEDTSGS CVTDDFNDKI KELETVMMGP DSLDLVLDYN DSFDSTSCQE TNSWRSTLEA  120
VSRRDLRADL VSCAKAMSEN DLMMARSMME KLRLMVSVSG EPIERLGAYL LEGLVAQLSS  180
SGSSIYKSLN QCPEPASTDL LSYMHILYEV CPYFKFGYMS ANGAIAEAMK EENRVHIIDF  240
QIGQGSQWVT LIQAFAARPG GPPRIRITGI DDTTSAYARG GGLSIVGNRL AKLAKQFNVP  300
FEFNSVSVSV SEVKPKNLGV RPGEALAVNF AFVLHHMPDE SVSTENHRDR LLRMVKSLSP  360
KVVTLVEQES NTNTAAFFPR FKETMDYYDA MFESIDVTLP RNHKQRINVE QHCLARDVVN  420
IIACEGADRV ERHELLGKWR SRFGMAGFTP YPLSPLVNST IRSLLRNYSD KYRLEERDGA  480
LYLGWMKRDL VASCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-661304978375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013621067.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1534430.0AF153443.1 Arabidopsis thaliana phytochrome A signal transduction 1 protein (PAT1) mRNA, complete cds.
GenBankAK1174830.0AK117483.1 Arabidopsis thaliana At5g48150 mRNA for putative SCARECROW gene regulator, complete cds, clone: RAFL17-10-L05.
GenBankAK3172520.0AK317252.1 Arabidopsis thaliana AT5G48150 mRNA, complete cds, clone: RAFL22-43-D17.
GenBankAK3177470.0AK317747.1 Arabidopsis thaliana AT5G48150 mRNA, complete cds, clone: RAFL22-04-F15.
GenBankBT0253260.0BT025326.1 Arabidopsis thaliana At5g48150 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013621066.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013621067.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013621069.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013725211.10.0scarecrow-like transcription factor PAT1
RefseqXP_013725212.10.0scarecrow-like transcription factor PAT1
RefseqXP_013725213.10.0scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0D3AWS70.0A0A0D3AWS7_BRAOL; Uncharacterized protein
TrEMBLA0A3P6D6580.0A0A3P6D658_BRAOL; Uncharacterized protein
STRINGBo2g149670.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]