PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619937.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 281aa    MW: 31993.1 Da    PI: 7.7349
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619937.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.95.6e-231862549
                    SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     + n qvtfskR+ng++KKA EL++LCdae+av +fs++gk+y +
  XP_013619937.1 18 KENNLQVTFSKRKNGLFKKACELCTLCDAEIAVFVFSPSGKVYSF 62
                    56788**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.8E-31665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.128666IPR002100Transcription factor, MADS-box
CDDcd002652.29E-31775No hitNo description
SuperFamilySSF554554.84E-25781IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-18828IPR002100Transcription factor, MADS-box
PfamPF003191.2E-231662IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-182843IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-184364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MMKKSKGRQK TKMVKMDKEN NLQVTFSKRK NGLFKKACEL CTLCDAEIAV FVFSPSGKVY  60
SFGHLDVETI INRFEGIENP PLNPQPNMQL DEIHRNSPIQ DLNNDLTELM NQLELEQKKT  120
EDLKNKRKNS KVPEIWLKDS IGGLDLGQAK EFKGKLENLK KQVRHEAFKM LEGRYPHPSF  180
YVGSSSNALF GVDGGININP NMNLFDQRRM VNMNNFYNHN MALPNHPLPF GNYGHAEGFV  240
PGYNYIPEPN PTGNQNPSSK EENEAGNEHH HDGHSPDPRS D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A4e-14774168Myocyte-specific enhancer factor 2A
3mu6_B4e-14774168Myocyte-specific enhancer factor 2A
3mu6_C4e-14774168Myocyte-specific enhancer factor 2A
3mu6_D4e-14774168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619937.10.0PREDICTED: agamous-like MADS-box protein AGL62
RefseqXP_013712956.10.0PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK21e-90AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A078F3Y90.0A0A078F3Y9_BRANA; BnaA02g06310D protein
STRINGBra020247.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2328644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-86AGAMOUS-like 62