PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619932.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 248aa    MW: 27952.9 Da    PI: 10.2442
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619932.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.12.1e-221461249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +ie + n qvtf+kR+ng++KKA+EL++LC+a+va+i+fs++gk+  +
  XP_013619932.1 14 KIEKEKNLQVTFCKRKNGLFKKANELCTLCNARVAIILFSPSGKICSF 61
                    59999**************************************98766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.6E-29564IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.694565IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.59E-26682IPR002100Transcription factor, MADS-box
CDDcd002657.96E-31680No hitNo description
PRINTSPR004049.4E-18727IPR002100Transcription factor, MADS-box
PfamPF003193.8E-241461IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-182742IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-184263IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MRKTKGRQKT KMVKIEKEKN LQVTFCKRKN GLFKKANELC TLCNARVAII LFSPSGKICS  60
FGHTKVETII DRFEKTDHPD NNTQRNMQLG EIHQNSTIRG LNNRLTEVMN NLESEQKTSE  120
ELKKLRKKSK LPEIWLKESI GGLHLGQAKE FKGKLENLKK QVIYEAFKIF LATPFPHPGF  180
YGGSSSNAPF GVDGNVNAFD NHNMALPSHP NPFVPGFNHN MALPSHPNPN ESGNEHPNDG  240
NPPQPRSD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619932.10.0PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK28e-61AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A078F8401e-163A0A078F840_BRANA; BnaA02g06250D protein
STRINGBra020242.1-P1e-162(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1873848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-54AGAMOUS-like 62