PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619903.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 216aa    MW: 24548.2 Da    PI: 9.8176
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619903.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.33.5e-171050242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +ien+s r+ t+ kR+ gilKKA+EL +LC++ v vii s+
  XP_013619903.1 10 FIENESSRKATYKKRKRGILKKANELATLCGVPVGVIIDSP 50
                    8************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.348147IPR002100Transcription factor, MADS-box
SMARTSM004329.3E-24160IPR002100Transcription factor, MADS-box
CDDcd002661.80E-26285No hitNo description
SuperFamilySSF554555.76E-25294IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-10323IPR002100Transcription factor, MADS-box
PfamPF003193.3E-171050IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MTRQKVKMAF IENESSRKAT YKKRKRGILK KANELATLCG VPVGVIIDSP YDLTPEVWPS  60
REDMDNVLSQ WQRLPVMDRT KKMLNQESYL KQSISKATET CKKLTKENKE LEMKEVMFDC  120
LSGKTSPPRI EKSDLRGCGN VIEQYLRNLN RRIEILSKND GASSSSVHAA ATTSVAMPIV  180
ELGSSSTAFC DMIRQQQIQS NMNQNVRGLD LNQQQW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619903.11e-161PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_013675571.11e-161PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_013675572.11e-161PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK33e-55AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A078GER91e-161A0A078GER9_BRANA; BnaC02g40080D protein
TrEMBLA0A0D3AXE11e-161A0A0D3AXE1_BRAOL; Uncharacterized protein
STRINGBra020555.1-P1e-143(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.11e-82M-type_MADS family protein