PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619615.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 395aa    MW: 44682.1 Da    PI: 6.0055
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619615.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.46.8e-171052244
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    +i+nks r+ tf kR+ g +KKA+ELS+LC+++v+ +i s ++
  XP_013619615.1 10 FINNKSIRTQTFKKRKRGFMKKAKELSTLCGVKVSAVIKSCDN 52
                    89***********************************999877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.311161IPR002100Transcription factor, MADS-box
SMARTSM004326.4E-18160IPR002100Transcription factor, MADS-box
CDDcd002661.24E-22285No hitNo description
SuperFamilySSF554553.53E-20295IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-141052IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MTRGRLKPNF INNKSIRTQT FKKRKRGFMK KAKELSTLCG VKVSAVIKSC DNAEPEFWPS  60
KEGAEAVHSE FMKVVETQGF SKMHNHESYL LERIQKDGEK ARRLHAENRE IELREVMFDL  120
LKGKTLMPHQ YGDPSFMREL NLFIGGYANR VTYRTQFLEG SVEPVPPNVA GANAPGPVVG  180
DVNPVVVGTE GSVIDPTEAY DHMPQYDSMD MSVNVEAPEQ FQYQTHANYY DQTLPWFNGS  240
SQGMNVNHQE PFQYQTPPNS YDQIQPMFNG SSQGMNMKYE EPFLYQPPGN LYDQMQPMFY  300
GSSQDMYTCL GHDQGQSSNQ YPNAKQQFMS LLMGRPQQMS DVQDLASVAS MDDNNNRYQQ  360
LPVTSQMPST TTTTAAANLS GHSINNGCPT RFCLD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619615.10.0PREDICTED: MADS-box transcription factor PHERES 1-like
TrEMBLA0A0D3AXJ80.0A0A0D3AXJ8_BRAOL; Uncharacterized protein
STRINGBra020525.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14795620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65330.15e-31M-type_MADS family protein